SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03277 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03277
Domain Number 1 Region: 2030-2172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1902-2010
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 3 Region: 1600-1644
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000915
Family Tachycitin 0.017
Further Details:      
 
Domain Number 4 Region: 667-726
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000654
Family ATI-like 0.036
Further Details:      
 
Domain Number 5 Region: 2750-2811
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000147
Family BSTI 0.05
Further Details:      
 
Domain Number 6 Region: 995-1051
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000018
Family ATI-like 0.031
Further Details:      
 
Domain Number 7 Region: 3087-3146
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000245
Family BSTI 0.031
Further Details:      
 
Domain Number 8 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.024
Further Details:      
 
Domain Number 9 Region: 724-764
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000471
Family Fibronectin type I module 0.066
Further Details:      
 
Weak hits

Sequence:  Aech_03277
Domain Number - Region: 3472-3549
Classification Level Classification E-value
Superfamily FnI-like domain 0.000241
Family VWC domain 0.06
Further Details:      
 
Domain Number - Region: 125-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 3542-3629
Classification Level Classification E-value
Superfamily FnI-like domain 0.000827
Family VWC domain 0.024
Further Details:      
 
Domain Number - Region: 2288-2324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000873
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 1043-1089
Classification Level Classification E-value
Superfamily FnI-like domain 0.0022
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 3127-3211
Classification Level Classification E-value
Superfamily FnI-like domain 0.00293
Family VWC domain 0.012
Further Details:      
 
Domain Number - Region: 3343-3405
Classification Level Classification E-value
Superfamily FnI-like domain 0.0439
Family VWC domain 0.08
Further Details:      
 
Domain Number - Region: 3398-3479
Classification Level Classification E-value
Superfamily FnI-like domain 0.0743
Family VWC domain 0.056
Further Details:      
 
Domain Number - Region: 2203-2230
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0883
Family ATI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03277
Sequence length 3753
Comment [mRNA] locus=scaffold140:90570:106924:- [translate_table: standard]
Sequence
MVSLQILGHLFALIIVANNIRQGNGYSEDMNAQEVNKEEDMLKDAPDSAIGGSYNVKSSK
GGRRVFAGGCTRRPSAPVNGKIKCSLDSGCTASCASDYKFPNGAFQLTITCVDKEWHVGG
TEWNSIPHCEPICMPECQNNGICVAPHHCDCPKHFTGPQCQFEDRPCLNYSPPVLNSYKR
CNAKTCTISCMERFTFPDGSSVANLICKNGSWMPTRSDWISIPDCEPVCDPPCQNGGNCL
PMNVCQCPQDYRGPQCQYSADICDAEKLHFNGGYHCRDSGDMYSCTLYCPSGIQFEFPAS
SIYTCTYDKGIFEPQPIPQCKVDNNIKIISHGTFHNTYVRESNHSWSMENVYNTKTKHSE
EIYEKYRVYDTNASSHPIQFNDDRITVFEINRPKPKTCFTWGGAHYKTFDDRIYSFDSDC
SHTLLRDTQDGVCTIVASNGPGCRTGSDRHCSKIVKLFVHDKKYVLTSDDTGMPIFSNNK
RSLPIPIYLPGLRVDKSAHFILVSLDSLGVKLKWDGALLLQIEASESMWNKTAGLCGTMN
DDPNDEFLMKSGSYAQTIPALASSWRVGSFEETCDDYPNIQHACKSKDEFAHDALQLCVQ
LLSNNKFKACADTINLPELTDACLWDYCACKYEDRKKCACDTMDVYIRQCAHKGIARSAA
WRNDDTCPINCDGGRVYMSCGPKVEASCTSSIEATSGSSECEEGCFCPAGTLEHQGKCVA
PEECPCRLRGKLFQPGTSVPKGCNTCTCTSGKWVCTQIRCGARCAVLGDPHYTTFDGKHY
DFMGKCKYYLMKGENYTIESENVQCSGAISQNMGFASAGSPSCVKAVTITFKNTSIKLKQ
NRQIAINADEITKFPTLFDGARVRIASSIFMVIHLPNALEVWWAEFYGQTKGLCGTFTEN
QKDDFITPDGDIEPAAIAFANKWKTSEYCIDEPENEPKHPCELNPERRATAEEHCSKIYS
DIFSGGVWECRLATPDEIREYPPVTELLSVCQASKHLEVTDCEPVEQRTCSNMHIQSEQT
PSVCTSGCVCKSGYVLDTSNGVCIKEEDCPCHHGGKSYKQGSVIQAECNTCTCEGTKWKC
TDRICAGICSVWGDSHYKTFDGKTYDFQGVCDYVLVKSTLNKEDCFDVSIQNVPCGTNGV
ACSKSIKLTIGSGEQQEELILTKGKELPKGSFKRLSIRSVGLFVFVDVPDLGLVLQWDKG
TRVYIRLNPEWKGRTMGLCGDYNNNAEDDFKTPSGGISEASVNLFGDSWKKDTFCPEPKD
VQDVCEQHPERKLWSLRQCNVLKSPLFSPCHSEVEVEPYLRNCIFDTCSCDAGGDCECLC
TALAAYAHECNIRGVPVKWRTQELCPLQCDEKCSTYSPCVSTCPRETCDNSMIVRDGSHL
CAEDTCVEGCQFQSCPEGQVYRNASYTECIPKSTCPKPFCIEFDGMTYYEGDRVSGDDCH
SCFCSRGKVICKGEACTSMTTAGTTAVPLIEPQKCIDGWTKWINEDPAKGKKFLDVEPLP
KSMDLATANGLAVCNREHIVDIKCRSVKEHLSPKETGLDVECSLERGLYCQSHPDLPCVD
FEISVLCRCSEPTTHGVEKTTTEISTGIGEKCDIAQPSSPHPTNCQLFYQCVPTLTGYEL
MERLCSPGTLYNSETHVCDWPTEVLRTRPECSVESGGTTQASGRTEWSSNSTSHYNNILS
TTVKKIVSTMKVCKEDETWSDCAIQCARVCQYYRHILMTQGLCNEGTDCISGCISIDRPT
CPSHKFWRDGITCVEANHCSCKSHDGGSVAPGAIKKESDCETCQCINNYYTCDTTLCNIS
GHEVTAGTGRGPETTVQPPLSTTLRSTWETLPVIGSSVSEQTILLHSTVTPPGECSDANY
VPLIQNLREEVIIRSSGNRNSVLRSEDLLVYTEGTMLLPKKFWEPEMLNTDQWLNIEFNK
PEPIYGVILQGGVSEDKFVTSYKVLFSEDGQTFSYVLDHEKQPRVFRGPIDKIQSVKQIF
YQPIEAKIIRINPLTWHNGIGIKMEVLGCQDHITSTTTKTTTSEKVVIPICEDSMGLDNG
LMTMQQISVSSSPQLVQYLRLSTESAWRAALDNPHQYVQFNFLEARNLTGITTKGGGGAW
TTAYKIFYSNDGRYWNPVVDENGDEKVFLGNFDTESQRTNFFERPLHAKFLKIQPVKWHD
HIALKVEILGCYLMYPVSSTTSTTKSTTLFNQECNVCDGIDQTSNDEGCKCEDPYWWDGE
SCVPKRECPCVVGHVPYAVGSMYETDDCQQCVCSFSGTAACLPKKCEPCLEPGLRSVVGE
LCACLCKPCPAGTRHCPTSDVCINETAWCNGVQDCPDDEMDCPKIISTTPIVIESSTTIK
QEVTTISPPPLPCEKPICPPGYRVVFKQASQLHDKPHHNVKTNVKSKGHKSFTKMKEYKK
HPYRHPIHDHPMKDQLATENIQCPEFICVPTIRPPVYPNGEKPEKCPEVFCPPQYEVIYE
KMSMYKMHKCPKYACRPLPPQEVICNVTGRTFNTFDNMEYKYDICNHILARDMYGNEWYI
TLEKQCTDSRGQQSCTRVLAVMLNERAIVLYSDLHADIDEYTFTAEQIARLGNRLPGFKL
SRTGDKIIFVSHRYGFWVIWDSGTNVKIGITTKLADRVDGLCGYFDGDITNDRQTPEGTQ
ARSTVQFGDSWAMENTECDVHVCPHDVQERAWTICNSVKSPILLDACSAVVDVDRFVSGC
VESMCSCLQTSNSSYEDCRCRLLTSFVGECEAIIGPGADPLSDWRTAYDCPVSCPSPFVH
RDCFRSKCEITCDNLHEVEPCPPMRGVCFPGCFCPDGLVRRNDECVPPAQCRDCVCDGLG
DAKFIDFNRQGFMFAGNCTYLLSGNIVENAKSREEARVYQILITNGYCDTGTCTEAITLL
YEKHIVQIKRAERSKDLRVVINDSQVENFPHNLTWIVLNRMSTGDVTLLIPSFQLELVIF
QQNFAFTLKLPSHIFSDDTEGLCGSCNADAENGFEKRDGEITNDVEEFGKSWLVGKDLLT
QLGWSDQTCSSNQIECTPPPEEDLCKKFLLDLATFKQCHSIVDPKPYLDCCHDALCTDRN
YCDSLEMYARKCSEASLCLDWRSNEICPYTCPKDLVYQACESSCKETCDTINGSDNSKCA
SDLIEGCFCPVDHVFHNDSCIPKKNCFVCDKDGHVQGDIWHPDKCTECNCNDGVVNCQTM
ECPVLDTICEENMTPVLINGTEERCCAKYLCAPKPTAPTICIESQEPECGFGQTMKVITD
TDGCHKFICQCLPVSECPIFDNFTNEIEQLQPGFIHIMNISGCCPRPSKICDPRICPSAP
NCPDYYNVITTMLVDSCCPTYECVPPKDVCLYTNNEEQGKQQVAKKIGEEWKDGKCKTCV
CENSDDGPKTNCLFTECSSMSAHPDVNDYVLEEILLDDKCCPIFERTACKWKGNIYNIGE
SWKPNIEDACLMMQCNKDSVTGGIQILNKFQECDTMCDYGYKYQVPKDTSVNCCGTCIQV
ACIVEGMLKNVGEQWYSDDHCTMYLCKSINGSVYLEASTETCPEIDPQMKSEFEIEARKI
PGRCCPEIVKTACRNDGKLYKPGETWKSLTDSCVIETCVDGPNITKRKEVEVCSKQCSQL
SLAVSPVACPDVTNCPDESIYQDQCCRRCNMSINIKDQIKETCEAVFIDANSTVGMLSIN
HSFHGKCKNVDAIEGIKQCNGSCHSSTFFDSENWTQVNDCQCCQVKEYMGIIANLKCEDG
KRLKKQMAIPRSCSCQNCDSSNIKNENKTKKKG
Download sequence
Identical sequences F4W7U1
Aech_03277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]