SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03311 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03311
Domain Number 1 Region: 30-178
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-16
Family C-type lectin domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03311
Sequence length 452
Comment [mRNA] locus=scaffold140:410954:417066:- [translate_table: standard]
Sequence
MKIILLLFVVAAFASAQRITTIQLDGIQYFVSRMNPYSPELNYFLAYQYCRSLGLQLASF
ETKEKADTMTQYLKNAGYTKYDFWTSGNKLGTDMFLWMSTGLPFNVTFDYMLKRPGNRPA
DVPPGTEPQRVARESGDSGSADGCVAMVAPTLAWEAQDCTLVKDFICEQTRCYYYNYGSI
PVSATQGNHRPYITTTSAPANDDQASDHGTDIDGTNIDDHHPGTNAQNEQEATPSEADTS
ADEKLSEDPVVNRLITTTAPASGNHYQQQQYQHTGTTAAATSSLFDDGNERERTAVGGLD
DTRPEHIPDIASLFTGHVAVTSQARKDSVFDGLETREVLRPSVSRPVVSSASSSFSSEMK
MEHRESPDYGDLAAETELPNNGLEDAHTIGPYDSVQDYVNDQPVDTAALSADSAMMKDQD
DDSSTILPDAEPAYRYNIKVRTNGKVLDPPSK
Download sequence
Identical sequences F4W7X4
Aech_03311 XP_011068006.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]