SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03319 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03319
Domain Number 1 Region: 22-97
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03319
Sequence length 102
Comment [mRNA] locus=scaffold140:468468:475571:+ [translate_table: standard]
Sequence
MRAPLLLLGGIVVLSLAVARALSCVCSPLECDVLTDEDCPGGLTWDPCRCCKVCARVEGE
PCGGLFGFSGTCAVGLQCVIMNLLTRSREVDEGVCTSEYIFI
Download sequence
Identical sequences F4W7Y0
Aech_03319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]