SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03404 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03404
Domain Number 1 Region: 136-381
Classification Level Classification E-value
Superfamily vWA-like 2.22e-77
Family Integrin A (or I) domain 0.000000705
Further Details:      
 
Domain Number 2 Region: 392-471
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-16
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 3 Region: 656-749
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000144
Family Integrin beta tail domain 0.0039
Further Details:      
 
Domain Number 4 Region: 564-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Weak hits

Sequence:  Aech_03404
Domain Number - Region: 30-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.000282
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 616-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 529-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03404
Sequence length 824
Comment [mRNA] locus=scaffold140:2550642:2560450:+ [translate_table: standard]
Sequence
MARWTKIIVYLLLVTAHLFVAAVSQYRDRESLCESRQTCASCLQTPRCVWCSMTASTQNV
NAPLLRCVSKQTYLKEGNFWCQPSAVIDHENTMDILENQQLSSIKGKDPVQIQPQRIRLR
LRSGEEYRVTMKYGQAEDYPVDLYYLMDLSASMEPYRDKLSKLGLQLAKAMQKLTSNFRI
GFGSFVDKVVLPMTSTQPDKLESPCILKTGRPCAPPYDYKNQMPLTENVALFEDQVQAAP
VSGNLDGPEGGLDAMMQVIVCTKEIGWRQKARHLIVFSTDAIFHIAGDGKLAGIVEPNDC
KCHLDENGFYTYSLLQDYPSISQLNRKAREHNMNIIFAVPDHKNATYQRLSRSISGSSTG
TLENDSQNVVALVSSEYEKLVDSVTIIDTAPKIIDVKYFSRCLNKTGELLERQECEGLRV
GNIIEFEIVLKVVECPKDPKDWYQTMEIKPRGLNESLTIDLEIICDCPCEKSGHLGYQPN
AIECKGKGTSVCGVCSCNSGFYGKQCECEGSDIGADKLNSMTDCKPDNHTVEICSGHGTC
KCGVCDCDKRPNNPQELFYGKYCECDNFSCKRSGGQVCGGRGKCECGTCNCLPGWGGETC
DCKETNNTCIPPSGENVEICSGRGNCICGSCHCHERDNIRYSGQYCEECPTCPGQRCEEL
KDCVECVAYNTGPLAENGKCDLCMHEIDIVDIVEEDPTKNEEADARICRTPGDAGCTFVF
KYQYHRAGTGGDIKIFKIQAEQERACPTPINVFGVALGVVISTVIIGFLILLIWKILTII
HDKREYAKFEKERALAKWDRGENPLYKQATSTFCNPTFQEYARN
Download sequence
Identical sequences F4W856
XP_011068116.1.86870 Aech_03404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]