SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03631 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03631
Domain Number 1 Region: 22-268
Classification Level Classification E-value
Superfamily Kelch motif 1.22e-37
Family Kelch motif 0.017
Further Details:      
 
Domain Number 2 Region: 235-354
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-18
Family Kelch motif 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_03631
Sequence length 398
Comment [mRNA] locus=scaffold221:1108543:1110807:+ [translate_table: standard]
Sequence
MMDAGMYTFKPFVFTKPVVKGKEQPKARSGHRIACDHRNLYSYGGFNPCVSDTDPDMRDD
QMWSASKPLFKELWRFNFVSKRWSRLPGQENMPNELASNAVILCGNTLMVYGGTGVPFGE
SCSNQLYVCNVDDGAINAVPAIGELPEPQYGQALVCHGSYLYTVGGTTGYEYTCDIHRFD
LRRGVWEVVYICSGKDESEPHGRYRHELAFDGKMIYVLGGGTSTESYGFLEIPAFDLKTN
SWKILNTHGETEETMVPAPRRCHGSVQYTDEKNGTTSVVISGGYNGDRVFNDVWRLNLST
LRWTRLRECILPCPVYFHSAALTPEGRMYIFGGIVKMNNKVKRTNAVYSAWLTIPKLSEI
CWEALNYYWEDLKDASPDELLSMGIPLKFVQRLEFCDW
Download sequence
Identical sequences F4WEK0
Aech_03631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]