SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03867 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03867
Domain Number 1 Region: 916-1030
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1760-1848
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000693
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0085
Further Details:      
 
Domain Number 4 Region: 2393-2504
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000262
Family C-type lectin domain 0.0092
Further Details:      
 
Domain Number 5 Region: 442-698
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000209
Family Galacturonase 0.056
Further Details:      
 
Domain Number 6 Region: 171-261
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000248
Family Galacturonase 0.05
Further Details:      
 
Domain Number 7 Region: 1334-1578
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000864
Family Pectin methylesterase 0.049
Further Details:      
 
Weak hits

Sequence:  Aech_03867
Domain Number - Region: 358-429
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000549
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number - Region: 1036-1138
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00184
Family Pectate lyase-like 0.088
Further Details:      
 
Domain Number - Region: 2122-2370
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0105
Family Galacturonase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_03867
Sequence length 2858
Comment [mRNA] locus=scaffold153:2165366:2209711:- [translate_table: standard]
Sequence
MPILLTAAETQVPSLRTSPTIRLVDGPSPLAGRLQLFHKGDWRSICTNSRNWTRANLETA
CRQLGYQGGQWWSWIDRQWPSKPRLLYEEPGCRGTEPSLTTCEHWSERELGAGVCDYHPD
LGISCLPRHDGASKAIKHWRGIRFEDAVYDKQKLIQQNTLYVRQSLSILQNTVIKYAGTG
REYNITSAIHVEGVPPIMESISVLHSAFTGINVTTSDASVVINNCTMQYNRGYGIYVNSS
SGMAHINNCTVSENGADGIKYVHADERPDDKLERNDVYDLCTFPSTVSQTFPITISMQQN
KYAPNVKECPQCKNGEKQPQIALILTNVIQVMILNSIQEVFSHRSDILGNANIGDIQIFT
TLGYVLTVHFLQMKTDRNDSAIIEVYDGTVRLLATVKVRNGTLPQSVTSTGHNLFIKFIA
EPRTNALVFVRVSSGYKKTYDLNVTGSTITSNNGRGIIVEKLRSALHIHETSVSDNNHVA
GVHVLGGAMDVNITDSRIAYNQGDGVNITVTGGNRNVSRSSISSNSGYGFAVWLNDSSAT
EYVHFNQSTVIEYSQIFSNKDIGVLIGNSTGNSYVNVTGNWFNTSFETALQVESSWRKDN
GLMRVQIGHNSFIRNEKLGIKLSPALNLDAIIEYNHFVDQATGAILIKNPLYEEFNILPA
EIVIRYNEFYNNQGTFIVSIGLSPYNDAQKLLFTRNFLKHNRVRELFDNGDMRNVKLIPR
SRVAAVVVVSSSNVHVFRNILNNLDSRYEIGSHLEDQSKVINCTYNWLGSAEEKIIFDRL
FHRKDRYNLAKIEYLPYLLHNSNPGANTIIPNPTFVPQFIRSDSNEVGGEVDGQEELKAG
EYIVKRDINVRPGGKLILQPGVTLRFPPAVGMMIAGKFDARGKKPSDILFTLKEELVMLS
NNDTFTDENIQVHETESMPVRLLGGKTNLEGRLQVKIGNEWGTVCNYGWTIQDAALVCHQ
LGFILDFENWLMERSQIPNAGINEKILLSNVRCTEYDNDITKCRAEREQDFENSCTHEND
VGVRCLEAAWAGLRLGPLAQRSDLQYVTIEKAGLLDYKTNSFKPALEIDFARHSLNGIKV
LNNLQDGLGVLYSDIYSADAINTVTNSDFSQNGGSGISFKQLGMRIVNSRIENNKIAGIR
HNPALSAVQQREFAGWFLRKSDTTVDSPYNPIILPETTENIELANGETKYIITTKVTSDS
VRRIINIECKPSYVIGIQLLNPIENRSTEQIILHDSQHFDINQTVWHVKRDLSVFPVSSS
SFVVLLEYDSGENALGGTVIVVTSLSAPRQNIHNKIVNGPIPLLSVTKTKIKNNKKGVLA
SYYNRYLNEIGYHFLRKANETIQLVECEISHNHEEAVYVHSPYWNIFQSNLSEISIHINN
SLITDNGKGIHQFSRDARHSNNLFHWIMQDSTIERNHGGGFEVLLPDVWQYNENFTHSLY
FGNNTWRNNEQFGFVVDGHFAHLNISYNRFDSNRCKTGLISMRGMEKKIRIDNNYIEDNN
GMYMVEFRANSQSEILGDIYARFYRNEIKRNMYDLSNLGSRRTFDDPSYVVGFHGIQKVQ
VHKNLFGENSLDYELLAGIRTAKINNEVDVRENWWGTANDTSIRQRIFDFDDWNDHAVAN
YRPYLTSDSFEASTSAWRHINREIDLNNLGGRIVDNLSLYAKPEPYVIHSDITVMPEATL
HIYPDVVMEFAPNVGILVLGTLKAIGVPGHEIIMRPIKRIDASANSTFSKLTPMKSSTNI
MSMPDEMIRLCKDGHCSVLHYEGFLEYFNRTTLQWIPLCDDRFTERNAQVACRQLGYDTL
NVYVSYDRRYELHPGSLTRVWSWPEPLQCSGKEQSLEDCQIRLNGQLFGHRHECPWNGNF
VFLHCGKRNLDDAYDYWGGIRIANSEFEAHLYEHHIHDIVTHETIRRVESVLKFINITGA
GILHYEKSAAIQSIMKSPAIVHVNIDHSAYHGINVVSPTHMVELLFNTINNVLGNGVNIL
SLTGEGRESDESTFTPIKDLNVPYHLFSMVDICDTAKEITIEERVIVYYKYDNYPVNCVK
IFRSAYRVKPFGFRLLQFNLYNSTGKPGRHDSITIYDGDIYNISTKVIGHLEVNTPDEKK
LFRTQNPSISIRLFANGANRDVQHNVSYSLISNCREGAVKYASAGEVNAIITLERNQFVN
NCEKLYGNFTTCKSALWLDVQNTQLLHFRNNLVQRNQGGLTIRADSSGTATSLKGWIHNN
LFTENFNKPALFVEGRQSSPYQQMTIFRNYFTKNNAPYDNNIILKQVVSNMTFNYLHGNL
GMHLLEISGFEKVRSQFYQSTSHNGFYKNYAVDREGRSTIIAGTPGQQYVDNVFFNPDND
YEMQTTNKSQQLEIWRSHIDARHNWWGYNETLAVAGRIRDREDSFELLQVDYQPFHMNNK
SVLNGKCPPAWDLVGDTCYILIGAPMDFYSARDFCRSANASMPFIMGDYLELWKFARKQQ
ERFDYSERVWVQQLERVDQCTMFTYQTIEIDHCAQPNLFICEIDPRVNIDPLSWRKDIVA
VGVLGAVGVALALLTAAIVLWASKSKKRKLERLERRNSIRQSLHSLRSVGSTSGFTELAY
RRKPIATKHSTDTLNSNYKRMLNGGSLDSMDKSQLNSSIEDNQSYDVYEAHNPRYSPSTS
DFKNTVQKYSAAQSVDNPVFDLAYRNEGFRNHSTFAARNGTADGAVAAAASNWSSPNIQS
TSVDESPTVYANNESSSYLNNTSTLPLHSSIALTDSMIELKRDIEASSGVYDPMDYLKPP
YDSTMLTPSQASEPVPEYASDFQPPVPPHPYHYEAESRPRSEALLETNFDTGEEKPLRSK
SEVLLETNLDAFLVNEPTELTQLSAATRSKSQPLETAM
Download sequence
Identical sequences F4W9C8
Aech_03867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]