SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03996 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_03996
Domain Number - Region: 15-53
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0386
Family C-type lectin domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_03996
Sequence length 80
Comment [mRNA] locus=scaffold220:1862745:1864759:+ [translate_table: standard]
Sequence
MDNKGFQGEDQVQRQKLKKMFSWTDGLPNSSVVLDVGTYDVPLGNESCAAYFGETEFAIA
RESDRQWPASAARDQAVYFA
Download sequence
Identical sequences F4WEA6
Aech_03996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]