SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04188 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04188
Domain Number 1 Region: 677-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 2 Region: 735-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 255-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 4 Region: 834-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 5 Region: 198-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.049
Further Details:      
 
Domain Number 6 Region: 789-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 7 Region: 325-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.058
Further Details:      
 
Domain Number 8 Region: 881-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 9 Region: 394-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Laminin-type module 0.062
Further Details:      
 
Weak hits

Sequence:  Aech_04188
Domain Number - Region: 635-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_04188
Sequence length 938
Comment [mRNA] locus=scaffold482:301444:328793:- [translate_table: standard]
Sequence
MSFGKRRGALVQTEIRLARDQDVESFVADRAVSLEILLAQPSSKDEHSREYSSREVREVY
QVEYVIVKSANSPRPAAWILERSLDGENFQPWQYYAPSDGECWTRYSAPPVAGKPVYVTD
DEVICTSQYSRQTPMENGEIHTHLVNGRPGALNHSATLQEFTQARFVRLRLQGLRRNGEA
DKRRAFYSIKEINIGGRCLCSGHAARCRYSVQHGHQECECERHTCGERCEKCCSMYNQIP
WKPGTAGKGFHCEKCNCNGHATSCRYDQEVAERRMSMDIRGKYRGGGVCVNCSEHTTGIN
CEKCEIGYYRPNGVAPDASEPCLPCDCNIRGSTGYCTPDDSYTRMGKVAGACECKPGYSG
YKCDQCAAGYRQFPDCMPCPCDSRGILPSHDCEGDCLCKANVAGDFCDRCKPGYLALSKD
DLDGCMSCYCFGVADRCTTARLQYSMISTLENWLVTDMNASRAIVPTLDTDNEWLTVAAF
DVEYDSPFWLAPQIYTGNRVSSYGSNLTYSVTWVVMRGDTSGKPTMEPNVILVGNNGMRI
AYGEEQYNGQEAEIAVPLREQDWFHVRSDVQDIPTRLRRTEFRGDPVTRAQMMRVLADLK
YLMIRARYHSEQIEGSLQSAILTIGELSPDGETDNLVEICECPEEYTGMSCEKCAWGYVK
MPINGSNHQDRHKCVKCDCNSHAGSCDLIMGECGTCEHHTVGPKCDRCATGYYGIATRGT
REDCKKCACPLSVDSNNFSPSCQLDDPTDMNSGYVCTQCPEGYTGDHCETCDVGFYGNPV
IPGGTCERCTCNGGACDHETGRCLECRGNTEGWKCEKCKEAHYGNPLEQNCMPCDCSLFG
SNSVHCEQTTGQCPCRSLFTGRDCSSCIEGYGNVTAGCRECNCDVGAIDGFCDSVSGVCR
CAPSVVGFRCDRCDVDTYGLSADGCKGKCRHRYAHAFF
Download sequence
Identical sequences F4WV90
Aech_04188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]