SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04190 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_04190
Domain Number - Region: 156-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_04190
Sequence length 311
Comment [mRNA] locus=scaffold482:372121:376038:+ [translate_table: standard]
Sequence
MGSTRICVQLCIFVAFIAAVVEADRDIFLSECPGPLTYYKDLRCTPIYDDKKDNCPKSFN
CNHIKRRSRDKCYINGRIYGPNQVLNPNDSNFCDISCICRVSFIQNQIAAFQCSKHSQCT
EIEVKNGCYLRQNPTTCCKNQKQICPKKLEDIPVCDVNNHIYLDGEYFKVNEEPDLICIC
QPGYKGENVPPFCIKPNHSPCFHPAFNHDDYFRRNCAPVFKDYVKKNTCYETMLCQLPGD
VVIPSRLPFMMDDNYSNMCIFGNLLLQIGDRLQPTPSYTTECINCICEVPPVLTCIYISK
NNCSINYFVNL
Download sequence
Identical sequences F4WV92
Aech_04190 XP_011060315.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]