SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04302 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04302
Domain Number 1 Region: 1273-1391
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 1388-1499
Classification Level Classification E-value
Superfamily Cadherin-like 6.52e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 593-701
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-21
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 1161-1277
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-19
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 694-802
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-19
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 7 Region: 823-922
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-17
Family Cadherin 0.0026
Further Details:      
 
Domain Number 8 Region: 916-1055
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-17
Family Cadherin 0.0036
Further Details:      
 
Domain Number 9 Region: 346-496
Classification Level Classification E-value
Superfamily Cadherin-like 4.95e-16
Family Cadherin 0.0073
Further Details:      
 
Domain Number 10 Region: 1500-1595
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000857
Family Cadherin 0.004
Further Details:      
 
Domain Number 11 Region: 130-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000003
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 1061-1161
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000171
Family Cadherin 0.0043
Further Details:      
 
Domain Number 13 Region: 1618-1743
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000131
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  Aech_04302
Domain Number - Region: 471-591
Classification Level Classification E-value
Superfamily Cadherin-like 0.00157
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_04302
Sequence length 1949
Comment [mRNA] locus=scaffold482:2179754:2198194:+ [translate_table: standard]
Sequence
MLYGSRGVCSARLETQNPVRPIFDSLDRSSSSSVELYRVQTIGSLYSKAYGFSLFLSFSL
TIPSIPAVEAAYLLRMQYRPVHWLADTGWFSFRSGTTPSFNDTEKVTMWAILLLSISTWS
SSWSQVINRAPHFIQGGDMARLAVSEGTPPDVPVYTLRGEDPEESRLHYSISGEYFTVNR
ETGVVILRKALDRETQDLIEVIISITDEGIAGSEPNTVSLRREIAVLDENDNPPVYHNRP
YAARVPENAQVGSLLPPSGTITITDRDGGVNADVHVQCVSASRDDDVCEVFDISTEKIAE
GEYNVRITLAKPLDYERRNSYLINLLAVDGASDPSKRLQARATVAVDVLDVQDQPPVFLN
APYSAALPENTAASHTVLMVRARDGDTGESRNLLLTLEDDDAGHFDLEMSRDGDVTVGRL
VTTNVSLDREDPRILQNGGIYTFQVKATELINNEIPADTATSIVTIVITDVDDLEPVFNE
DYFSIKISEDIGKNTPLPGLNMIVSDGDVGDNAKYFLALRDVPRYPGISKAFTVSPEEAQ
GRVPVVIKAKDVNVLDYDVDDPTKREIEFDVIATVASEVVATSRVHIQLLDANDHSPEFS
QSMYKLSILEDAELGTRFGDVYAKDYDSGSFGKLTYTLRGFGADKFKTDSQKGGIFVANK
LDYEAQKSYSLTMEATDGGGRVSAVNILIELDDVNDNKPTFEQPEYSRTVREAATSFDPQ
MFVRATDIDGPMQGNGKVVYSISRHNSMTDDVFKINPDSGEVTMSKPVRSGDTERGIYEL
IIRATDTGIPPLYSDAKLLVRVGVPGNQKPIFRGNYKSNLPGPSTYRARLLENASPGTEV
IRVVANDPDGRDNLLQYYIASGSKDNFVIDSSSGIITVSPDARLDLETGGEKYEVIVYAV
DSGTPVKETATTTVTVNIVDVNNKPPTFNESTYIVHVSERAAIGELVLKAVANDPDADAY
LEYSLVEPIKAVDKTGVALKNTASYDYKTAFRINSTTGAITVNRVLDYQVAAVVILTVQA
KDLNAVVDRDGQIAKVEVIIYIQAYSDDNPTFTNSGWSPNNPTIKITVPEEQPLGTTLLM
LSAKEPTTGYPVQRFELVREDDDEGYVNVGVQSGNVVLSKRLDYEVLNQKFIRFKVRALA
RDYDITRKMSEANVIIEIHDINDNIPVFGQKDYKISVLESAKPSKIVLNVQALDMDSSKT
EQEVQRGYGEVRYSLTGENANLFEVDPIMGNIQIAANTTLDREKQSVLRFYVVASDMPQG
GAEQRSSRVLVTIDVLDVNDNAPSFEQESYTAVIPENAPVGISVVNITATDPDEDEGGAI
NFEIIDEGEANGLFKINHTTGEIYSARALTGKGRTEPYNMRVRAQDNGEPALYSDVNLIL
YIGDVVSNDGVPLFIRPTLEEVAYIAENSTVGSPVFQVVASDPDDPNLPNGRITFRFLED
GNFGKDASAFRINSDTGLISTRKLLDRETKDSYTLILVAQDLGEPPQQATRVLQVIVNDI
DDHKPHFKRSLDSPPIELNILEEMPVGSKVGVIEAVDEDINENGMIGYEIVYGNEAGLFV
VQRLENNSAIIKSNGRLDRETVEFHLLTVKCFKYSSKKSDIVPKPYNKQDPSERQVLVKI
LDIDDNKPYFKKDNITLGVRLNVPIDTSLITLEAYDADSSALPINYNMSRVSFTSLVDSS
MSQKEIPSQLSLNARTGELRTTGSMAGYADGFMEMIMSANNSLTPRGETNITVRIFLLRD
RDMLKFVFSKPPVEVRKTLEDFEKAVQQALSLPISVNVYDTQFYSKEDNSLDFSSTSSCF
QMVGKESYDLDEMRSLLTDPRNKELKKVYRTYHVEKVQHCAAVVARADASMTQIWVLAIA
VLVGIATIISSCALCCMHAKYKRQVKHARLRDQPRPPLSYVSSGPAMVSSGSHTTLGPGT
MITLHDNIRECLHKLYKFFLRRNIFRSKL
Download sequence
Identical sequences F4WV67
Aech_04302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]