SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04394 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04394
Domain Number 1 Region: 232-293,320-460
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.38e-21
Family L-arabinose binding protein-like 0.00033
Further Details:      
 
Weak hits

Sequence:  Aech_04394
Domain Number - Region: 522-572
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00177
Family L-arabinose binding protein-like 0.0033
Further Details:      
 
Domain Number - Region: 584-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0217
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_04394
Sequence length 1119
Comment [mRNA] locus=scaffold288:1119177:1151216:- [translate_table: standard]
Sequence
MVTEGDQVLDDTEWLAMSSKYWKASKSARGTVDFAESKTKHNASPQCVRLPVNLFIQLIY
YYHISIVNNLSDLAEALGCLFKAGRLYCAFKRKRYIIEQPPSTDTLESRHRPKTLPQAMK
FLANCQRPERNVGINVGKTRFHEVSPELFSICCRLIDSTTVAESSCNPLETGQTFKGGRL
GYTFLAFFFYLLLAKTEGEVDSYIPSSDRNLRPRYIFDHLDAMLFPIAVLTARRDFRLLF
PTANLLRKLLQATIRANRTGHFMWVGSDSWGAKVYPVRDQEFAAEGAITILPYRNALKDM
SQIGLLKYILLRRYNTSFTAATNVDFDNYYLRLRPRMGDECGGQTEKNIPHKSLTDKTVN
CRNIWFQEFWSQHHKCTFSVNASSDMTRCTGEENLVDYEQEGLVPFVVDAVYAMAHSVHN
VIEEECVNNLGTSHYLCESLIPAPDGPRLLQHIRNISFIGELCKAAFLSKCKIVGRNLAL
IDPQLIDNPRQAKRNFPCTYLLVFAGVRCLVPASNYYDEGRQDTEIKFNSDGDAYGFYNI
YQYQRKDEGRFDYILIGTWREELSLDINMTRWATGVGELHIPRSMCSDNCPMGHVRNFVL
SNRAFSKPLNKDVKWESEPCCWSCVACREDAYVYNDTCKNCNPGYAPNSTMTGCIKLTAE
VIPWTSPWALVPLIFASIGILSTLFTTVVFIRFNRTPVIMASGRELCYVLLVGILSCYGM
SFVILSKPTTWNCTYLRIGLGLCLSICYSAILTKTNRISRIFNQGTKKIKRLSYTSPKSQ
VVIAIGDTQSLILDYVTPIYAGITAVQLIGTIVWLMIEPPDTTEIHPYPLSAVLTCRVST
FSLMMSLVYNMFLILMCTLYAFKTRKIPEDFNEAKYIGFTMYSTCIVWLAFVPIYFGTNN
DYKVQIASMCMCINISASVALGCLFTPKVYLVLFQPYKNVRPGHPNTSGMQSGNRAAYSM
RFAGGRSQTMQSVTSGSRSSPPMSRGGAGRPDERKHANEHRARTEAEVYVNGNDNGGDDH
HSGGGGDDDDDEEERKLSTVQELPELTASPPMSLAMCQARERSQAEPRHDSDQPRDRNEV
VISSISERVEARAKKEESCPNEEQILSYSDSPTFSEFSS
Download sequence
Identical sequences F4WIC9
Aech_04394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]