SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04553 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04553
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 92-210
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000209
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 3 Region: 217-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000323
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_04553
Sequence length 322
Comment [mRNA] locus=scaffold50:1619085:1626206:- [translate_table: standard]
Sequence
MLLKLDFRDEFKLEDSPDCRFDFLEVRDGQYGYSNLLGNFCGTNFPPEITSKTRYLWLRF
HSDENIEGKGFKAVWNTIPRPTYPGIPPEQEPCIFNITGMEMIIHSDLVKDRKAQAEKEG
LPLDCMWIIQVKEGWKIQLVLDVFVLKHPNECEANFVDIFAEKTDISSREKKFCGSIADT
IVVAKNTAHLRFYAEPKALNSTFEAVVTAIRDKKKSTCRDDEYDCEDLTCIAAELECNGK
VNCRFKWDEEDEKCKVSFSFVKFNISVPWPNKTLSNSRISTISGNSGTSTSCILSCILFV
CLLLLSTDFHRLLYRFSSSHKL
Download sequence
Identical sequences F4WW18
Aech_04553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]