SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04842 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04842
Domain Number 1 Region: 156-200
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000556
Family Kringle modules 0.0047
Further Details:      
 
Domain Number 2 Region: 3-41
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000749
Family Kringle modules 0.0042
Further Details:      
 
Domain Number 3 Region: 466-543
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000275
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 417-446
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  Aech_04842
Domain Number - Region: 44-73
Classification Level Classification E-value
Superfamily Kringle-like 0.000181
Family Kringle modules 0.0065
Further Details:      
 
Domain Number - Region: 559-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00221
Family C1 set domains (antibody constant domain-like) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_04842
Sequence length 638
Comment [mRNA] locus=scaffold344:1074683:1079536:- [translate_table: standard]
Sequence
MELAKNYCRNPTRDRRGPWCYTLDSTVIDEECDIPFCDYKECRMAGTANDYIGTLSTTRS
GRTCAKWLKNYNFEQIQRSNASLKTKPSSRFLRLIRTKSLSKRYLMTKQNLLTSSQLFMK
PPSLNLSQSGFKIDKHINFVDQTYLNDSLYPELSVQKANNYCRNPSRNIAGTWCYTTDPL
VPQDLCNIRDCEKSEECTFFVKGHGIGRRLYVLPEYRTEGLRFSLKTWEPDHPDSITFVF
TADDGLKSRYILKIGAFDNEKVLLYYESEEKDIILVKKKTLPHLLYLGKWSNFIIRIPRG
HVLLYYEGTSNPLFEWKHPEPSKAFLPIYYYYNSEKGHAIGVAFDCASRCHIENTQTNRY
TRILPLSIWSKEDVVRPNKLMLMIRAKGVVLIPLLLLPATSGFYALTLGERDIDGPPLDG
GWSEWGPWTCSVSCNGGIGTRNTITLIKKVIAYNHTAFTVKEYASVSLPSDSNIVNTIRI
ESPNSEIQWSHNGIFIQNNHRREIKDYEIIINRTALNDSGVYTLTVHRIDGIYMIIKVIT
LAVVPIKESITIRETLPMHITCHCAILGYVYSNLKIYWMINGNVWKDYGVTLPVATNVDY
VPTINKSHHGIWKCIVEQTDLKFKWTTNVIRVKGTKYI
Download sequence
Identical sequences F4WNQ5
Aech_04842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]