SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05037 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05037
Domain Number 1 Region: 418-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.11e-47
Family G proteins 0.0000252
Further Details:      
 
Domain Number 2 Region: 269-421
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 3.01e-41
Family Obg GTP-binding protein N-terminal domain 0.000034
Further Details:      
 
Domain Number 3 Region: 7-168
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000644
Family TrmB-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_05037
Sequence length 604
Comment [mRNA] locus=scaffold511:290383:293608:+ [translate_table: standard]
Sequence
MAMSIFNKNDSVLLVGEGNFSFSAALSRQNLNIELIATCYESGTNQEAAERNVDYLRSNG
ICILFDVDATKLEEYSSLKSRRFDKIIFNFPHAGGKMRIERNRDLLKDFFVSSERMIKEN
GQILVTLCNGQGGTPMDEPRRRWDDSWKIVEMAAHGNFILTRIEPFLWQSFRDYIVTGYR
SLDKQFHTAGSLTHFFTKGKLPMMHNIAPSNKIHTFKYTVDNITWKDMIKNIQDKLDIKS
LSATACIHKQESIALRSTKPKSKNDTLQYFVDIRSVKTIGGNGGDGQISFLRLWINDRAG
PDGGDGGHGGHVIFETTSNVKDLRHIDSVIRAKDGEKGYSKDCFGKNAEHNVVKVPIGTI
VRDVEGKILADLSKEGMMFIAARGGAGGHGNAFFKSDTQQTPEICEYGAIGENLQYVLEI
RSMAHIGLIGLPNAGKSTLLRAISRARPKIAAYPFTTLKPHIGIIQYDDYEQVAVADMPG
LIEDSHKNRGLGITFLKHVERCAVLVFILDVTQNEPWEVLQTLKYEISQFNERLNDRPHI
IVANKIDLPDAEVNLQLLREHIDLPIIPISAKIGTNVSTLLKEIRILYDNLKVTTSEKDT
ELSM
Download sequence
Identical sequences F4WWX5
Aech_05037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]