SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05130 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05130
Domain Number 1 Region: 462-721
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-53
Family YWTD domain 0.000000491
Further Details:      
 
Domain Number 2 Region: 375-453,714-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 78-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 165-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 5 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 6 Region: 124-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 7 Region: 288-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 204-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 250-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 10 Region: 335-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_05130
Sequence length 902
Comment [mRNA] locus=scaffold511:1802443:1814905:- [translate_table: standard]
Sequence
MQLDRSSTRPTNVSWCILLLLACAITPSISAIAHSHTNISDTLECKDTDFKCSNGRCIPN
IWHCDGDRDCPDGTDEDSAVCRLIPCNEREFECSPGECIPKTWLCDHQTDCSNGLDEKDC
YRTKTCTPEQFTCHSGNGECVALTWMCDDNPDCSDGSDEAECNDTCRSDEFTCANKHCIQ
QLWVCDNDNDCGDNSDEKGCGPITCHPGTDFACSENYCITSRWRCDGDYDCPDRSDEMGC
KDIQNGKKISHCENKEFDCDDGVTCIHQTWVCDGEKDCSNGADESPQRCHNVTCRPDQFQ
CEDRRSCISGHLYCNGKAECSDGSDEKNCTSKIVSCDPRIQFECSEGSCIPLENVCNKNP
DCIGWEDESAELCGVNECAKNNGGCSQICVDLPIGYRCDCRTGYRLIDNRTCDDIDECLE
PGSCSQFCHNEKGGFKCSCATGYLKDPRNLTRCKAAEGHASLLFARRHDIRKVALDRQEM
TAIVNNTKMATALDFVFRTGMIFWSDISEKKIYKAPIDEGNERTVVIENDFTTSDGLAVD
WIYSHIYWTDSGKDTIELANFEGNMRKTLIRDRIQEPRAIALNPLEGWMFWTDWSDEARI
ERAGMDGTHRSVIVGNDVKWPNGLALDLIGKRVYWVDAKLNIIGSCNYDGTGRRTVLYSP
ESLRHPFSITTFEDYVYWTDWDKETIFKANKFTGKEVEAVTSIRTLQHPMVVHVYHPYRQ
PDGMNQCQAVNGHCSHLCLPAPKINSRSPLLSCACPDGLRLLPDGLMCVENVTTTIAPST
QAPMMPFQRLKPLNVTTTNPLSSGDAEGKGNSVAESTDPGLVAGIVIGVVSLGLLLLALV
AVLCYRHYLHRNVTSMNFDNPVYRKTTEDQFSLEKNRFPLPAATVGEEAQEPLTSPGTND
YV
Download sequence
Identical sequences F4WX59
Aech_05130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]