SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05132 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05132
Domain Number 1 Region: 30-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000183
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_05132
Sequence length 96
Comment [mRNA] locus=scaffold511:1828596:1835031:- [translate_table: standard]
Sequence
MGRESRGVLLLVALAVLAAADAFSTDSKVACPLRQFRCANGRCIPISWVCDKSDDCTDNS
DESPEECKSKSRAELYEIRQINIHNSDDARDLYRRA
Download sequence
Identical sequences F4WX61
Aech_05132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]