SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05888 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05888
Domain Number 1 Region: 140-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_05888
Sequence length 203
Comment [mRNA] locus=scaffold104:258412:259234:- [translate_table: standard]
Sequence
MKTEVSWKRRLLRKKIKYMLVCVLVVAVIFVIHQLFYFKELNQDTVGKLIAGSVKDTHRV
VIGKQVDKWNQPYHSKLIRDTNGQTVSLRGTRDQDIAKYLPNINGKFVCFVSKREIDFVK
INDDYCDCPIDGSDEPGTNACNNGFFNCEKSSKKSAVRIPSYKVNDGHCDCCDGSDEWSE
AAVLYKLSKLKITFYGPKCPNKC
Download sequence
Identical sequences F4W4F0
XP_011049293.1.86870 Aech_05888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]