SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05927 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05927
Domain Number 1 Region: 563-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-77
Family Protein kinases, catalytic subunit 0.00000000402
Further Details:      
 
Domain Number 2 Region: 232-431
Classification Level Classification E-value
Superfamily Fibronectin type III 4.05e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-29
Family Ephrin receptor ligand binding domain 0.00014
Further Details:      
 
Domain Number 4 Region: 948-1018
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-18
Family SAM (sterile alpha motif) domain 0.00057
Further Details:      
 
Domain Number 5 Region: 158-232,271-278
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000361
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_05927
Sequence length 1025
Comment [mRNA] locus=scaffold104:609705:621284:- [translate_table: standard]
Sequence
MYIEINFTTRDCSLFPGNALSCKETFSLLYYEFDAATKEPPPWEPDSYKLIGRIAAGEGR
FNTNTEVVINTEVKSIPVTKKGVYFAFRDQGACISILAIKVYYISCPEISVNFAHFPATP
TGREVALIEQTRGICVANAVKIAQPTFLCKGDGKWYLPTGGCHCKPGYQADTDKQECKEC
PIGKFKHEAGSHACEPCPEHSKASDYGFTECRCDPGYFRAEKDPKKMPCTQPPSAPQNLT
VNFVDQSTVILSWNAPHMQGGRSDTTYRVDCDSCSMGVKYIPNTEIFNDTKITITGLNAV
TTYRFQVFAENGVSSLVGKSEYVDITVTTEASVPSLVSNVRITSVKSSELSISWDAPDIG
TGGDNDLVERYEVRCYPRYDDATNATVIQTSELSATFKGLKPSTDYAIQVRAKTTRGWGE
YTPVIFKKTPHAMGLDYVGEDDNMQVRIIAGAIVAVVVLLVIIIIMTVLILRSRASDECN
KKQPSDCDTLEYRNGEVHCKMDSSPIVTTHTNNKSKSSLTTPLFTPAVGVAAAGAGSAGG
AGARSYVDPHTYEDPNQAVREFAREIDAGYITIEAIIGGGEFGDVCRGKLKLPPDGRTEI
DVAIKTLKPGSADKARNDFLTEASIMGQFEHPNVIFLQGVVTKSNPVMIITEFMENGSLD
TFLRANDGKFQVLQLVGMLRGIASGMQYLAEMNYVHRDLAARNVLVNAALVCKIADFGLS
REIESATEGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSMGIVCWEVMSYGERPYWNW
SNQDVIKSIEKGYRLPAPMDCPEAIYQLMLDCWQKERTHRPTFANLTQTLDKLIRSPDTL
RKIAQNSVRPPAHNPYYVTSHTAAQAAAAAMPPGPVAGTAGPFVDIVGHQAHQQAQSAIA
VPVMPPGAGRSLHYHTHAATHALPHQQSPLTYPNWVPLGTNPLAPDAVDLTQLNSVSEWL
ASIKMSRYAESFERAGVTTLEAAARVTVQELTALGITLVGHQKKIMNSVTALRAQMSATS
QGFLV
Download sequence
Identical sequences F4W4I5
Aech_05927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]