SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05936 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_05936
Domain Number - Region: 45-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.031
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_05936
Sequence length 159
Comment [mRNA] locus=scaffold104:732586:739847:+ [translate_table: standard]
Sequence
MRSTDVFCYLIVATLAVLSTLGRAESNDDAHTSKPCNTSDLTEQCGKNQRCRVTSNGKQM
CECQRDFYFVDGECIRASTSTMTNVDVTTLKPEHRSESGGSSVAAGLLIPTFLIVVGVLL
YFGARRYKWLQRFRQYRHNRYGNVIVTRDDDDDDDPPIA
Download sequence
Identical sequences F4W4J3
Aech_05936 XP_011050202.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]