SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06013 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06013
Domain Number 1 Region: 1239-1378
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 2305-2416
Classification Level Classification E-value
Superfamily Cadherin-like 3e-24
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 473-604
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-24
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 246-389
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 921-1023
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-23
Family Cadherin 0.00099
Further Details:      
 
Domain Number 6 Region: 589-713
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 7 Region: 706-818
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 1025-1134
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 143-258
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 1470-1591
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 1135-1243
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.0047
Further Details:      
 
Domain Number 12 Region: 361-477
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000343
Family Cadherin 0.0088
Further Details:      
 
Domain Number 13 Region: 1355-1482
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000571
Family Cadherin 0.0038
Further Details:      
 
Domain Number 14 Region: 2417-2491
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000124
Family Cadherin 0.0051
Further Details:      
 
Domain Number 15 Region: 2071-2152
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000385
Family Cadherin 0.0068
Further Details:      
 
Domain Number 16 Region: 2196-2310
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000657
Family Cadherin 0.0039
Further Details:      
 
Domain Number 17 Region: 1976-2083
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000685
Family Cadherin 0.0035
Further Details:      
 
Domain Number 18 Region: 47-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000385
Family Cadherin 0.005
Further Details:      
 
Domain Number 19 Region: 818-899
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000385
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_06013
Sequence length 4720
Comment [mRNA] locus=scaffold433:368630:398816:+ [translate_table: standard]
Sequence
SSSWLLRSCKRSRFKIELYLIFGYLLTYCSARNNPPRFLIDGQTEIVLRLKEESETPIGS
LIYKLKGIDPDNDILTFGVREQPGSDVIQVENFGFNEANIYLNKLLDRETRDEYALVLTL
TDGRLGEGNFITQSLLLLVEDINDNVPIFRPHPTSLTLREDSRPGILTTVEATDADLGAH
GQVVYYLQELDGDNNVFSISTVNGKGVIRIVGSLDYERKYLYQLRILAVDRAINEKVNTG
TTAILIKVQDVEDQPPEFIAMTPVARISENVRIGTSVLQVRAVDGDKGINNKVTYSITKG
PRYLFDIDATSGLVFTRAQLDREAEENSDGTFILEITVKEVSKIVPPPSVSTEVTIILTD
VNDETPTFRSMLYRAEINENAPENTPVNFIGDAVPEIFDHDLGSNGTFRIFIEGDGGMFD
VTPFRGINEAPFLIRVKDSNKLDFEKISVVNFTLVAKEITPISPKYSAVPVTVFIKDQND
NYPEFTEDIYEVSIPENCVEGTTVAWVQALDADSDNLGTHGIRYTTLGGSIAHALTMDPL
TGVITVKHPGSSFDRELVARHYLTVEARDNLGKGNRNAAQLIINIDDVNDNAPIFLQNKY
EAMLLENEDHFESPLIVEASDNDLNGTRNSEIIYALVSSEFSRNFTIDPKRGIVTPTRPL
DYEALPINQGHKEMIIRQLRLTVRARDMGTPSLISDVPLMIYLRDVNDNAPVFERTLYKR
NIPEDSPGGTNIVQVKAWDKDLSSPNNKLVYRIQSGAGDKFVISPETGVIRVAPGSNLDP
DLTSPKTTRYNLNVIAIDSGTEIQQTAEVLVNITILDVNNKPPVFIDPGTVTIRENTQVG
AYVHRIVAQDPDVAPILRYRVDPNSSEARNEEGTLIKVQEYDYLAALELNALDGLLRIVK
LLVRGLQTASATLSIIIEDENDNNPKFRRPFYRRSVTENSKNGVNIVNIVADDADKNRSI
TYSLQGPKEITDLVHLDHETGEMVVANKIDRETYSWLNLTVKATDSGIPPRSSLSEVYVQ
VLDENDNNPYFVSNISNVTVMENSKIGTEIAVIQAADSDSGDYGKITYLLDRISSQGTFA
IHSETGSLTVADVLDWEIRHSYVLVIEAWDNYQFGYTAGESRNAFKQIQVTVIDVNDNVP
KMDIPQNCISISEFHDIRDLIYVIKVKDADDPTTPNGRVVIRITSGNELGLFLLEQTDHW
TAKIKAAQSLRGKFGNYTLNVEARDLGTPSNKDKGILKICVTDYNDNPPLFISPQHNTTI
RVPENITIGSPIIQIEAKDADTGLNGDVHYRLKQDLAGHWKTFRIDEKTGVISLKLPLDR
ETQKLYEIRVEAYDLGTPTPLSSDLDLIIYVRNINDFEPQFSVSVFNVNFTEEQPPGSEM
VLLPETFDNDDVDELDDPPTQVCYFIVGGNNGGLFVLDIYKHELGTAKLLDREQQEEHVL
LIKATEDCKTMPENQTMFDKTDATLLQVIVKVDDINDNAPQFIKDVFTGGVTTEADFGTQ
FMYIKAIDADAGNNAILSYYQVGKIHMTLTEGFEDMQMQPFLVNEDDGAVSLNFDPQRGM
KGYFDFMVLVNDTYGLQDTARVFIYLLREDQRVRFVLRQHPPEVRSRIESFREILGNVTS
AIINVDEYKVHENQDGSVDRTKTDLYLHLVNRRDNSILEVSEVLELVDRNIEKLDNLFKE
FNVLDTQPAKPEPIIQYEQAGTTFWLLTLTLFLGALLILCVALCLSQRASFRRQLKAANA
SPFGVSDSEFIRSPGRVPNTNKHSVEGSNPIWMHAYENEWFKNDESFSHTSERDSLDENA
LNNEEMMNEANTNQRSEDKPYYIEPRISTISRMLFVGAWFKAWVYLGLVCGWSKSARPRF
DTSTDMGLVLVPADAEVDSVIFRLRATDQDADFPLVFEITATITPVVRIDNLPCTLYNKV
CQANVILTKRLMPGRLHDFAVRVRDTKGDSNSMQATISATNATTSRDKIFPHIPSLIMVP
EDAKPGRELDYLLVRANSWSGKPVYIELWQPKELFTIRQRQTPTQTRGVITLIGELDFET
QSMYTLTIYATDPYTEPGKDTRNIAGLNVVVIVQDVQDVPPIFTLAPPLTKLNNSVQIGD
VILRVHAEDGDKGVPREITYGLVSEGNPFIPFFNISETTGEIVLAKPLEELTQITHVGAP
VVLTVVAEEIRRSKDEPPAQATVVDVGFLLGEPGNSPPYFENDNYVTSIPENLDPGSVIM
FPEQYSTRVHDEDIGKAGVFALKLQNNNGTFEINPTVAERTANFILMVRDNTLIDYEMHE
SLSFKIIAQEVGPATNLSASATVVIFIQDVNDNPPVFDEESYEVTLSENVTAGTRVIQVH
ATDKDTGLFGSIRYTGIIGEGSDAFAIDPDTGLITVAMGSSLDREMAAQLQLTVIARDEN
GKGNTGEVPLIVNLLDVNDNAPIFEKNAYEFTLNSDLTNFSTPAIIKATDADAEPPNNEI
RYELIHGNYENKFYLNEITGELTLLSPVTKFRRKKQSNYDNFSKKLHKKTQSLQPKHIIQ
ETIKKTTVFLNMTNSTESVPNEIELKHQIGEIKEYRRKRAETDILYTLTARAYDLGVPHL
ASETEIFIVRGTAMEARIMMFVISGDHPNLTTTTETLATITGGRITVLETRPYVSNNKTV
TSSPVPAGEKRTIIVARVEQTEIGTPLVDVEKIRNILAANGVGIINGVGTTNESMTDYES
TTKLPIDGVIHNGGDGTETYVNKTIIGDDEVTVYKAENKLLLWLLIILGLLMLLAIAALI
ICCICPGCPFYMAPRKRRIHSSETLIARSDGRPKRHLHRKPAIDIITSNGRKQAWSADPT
RRNWQFNRQNTKNDGLASLPGDVVYISERRPIDQANVESLRLRDGPTYDLSRRRFEEQER
IYVQDDTYERKARELRERDYDATEADSLQRHEIERGSDIQRQAYRQRYVDPELSNETAIR
EQHFYREGNAEVLQLVTRGEVEDRSQHRHYPTFIVDGKDVLLQRFMQDQKARHELPIQEP
EVVRTIDSHQRSRNLYQHKQEILLLPEELDVRRRRAEELESSAQKLAMDDKYATQNIDAE
SQMRDVRHQEISTNVPGISPKDKPSIVKDQTQSTTMQSYTFHDMELARQNALLTRILLER
ESRHAGGVMMDAASYLETQSLPGQVAIGTQTDRAAATQTDRHVRSRSDNDESDEDIRNRK
RIKKRHGESELRTRTLWMKTPIKEEEGPCFDKRLNILRKKVQAVKEGRKVSLEPEVLREI
SDSLDENGSTCREKARKSKTRQQYTEESSIGYKILGEKNGSSSSTEADKQHDKSSDEKRV
KSLSSPEINIDNGKYIRETMEKTSTRKESRIKKQKKVESVIKPSFRVLEKEITMLTKKLS
KLADKKVQQTTGSESTSQDKSKTSQDSKKDSGSTSKKTEDSKKHKRFEVSPSTSKETKKE
KFKYQQPQIMSAGSSENEDAFEKTKKSKLTSQEAAKHKQTSSHTKVKRQTLERKERKKQI
IQQDRELEKRRKAASKESGRPKTDKITSRMQKLAAIGRKKHISEELSTSTSSDHMNSKKD
SFMSRDFDKSTESSEIPSNHADQQKSKQKLHVSEKFSDDFVPEPQRRDIDQPSVFLPIMN
RNIDKEDVVNGKEDIEIIQQFSDDFVIEPQTKKLKHQMQATVESKVFSSNKENVYHDFDK
EYSTLKETIEDLAIVQNVEDTQHKSETILDIPSKEQSELFEVSKRELKDSSKRIMPSDSL
ITKALEETEKVPFYSEKRAVERRIAYMSGKHKEIAEESSYETEQEMSEKEEVIPEKELHE
IQRSKAVEEIVSEKAIALEKHIESLTKSIDGTEYIEEEKEEEHKNGYTSLYSSETDKTEE
LYKTESDQKEELSLESEKHVEEEISSTKDAIDNGQKMEELMQRENEEDLLREIKNDVERP
KEYEIQESDVEKKEESTIHTTASEESFDTSRPFTDDIKNLNGFQRAFAIDDDTLLYIDET
DDLTTKIEIESHEIKKESHISPERLSDSHKTKEEEFDEDKLLTSLSDITTSKKEVIKEQL
QVEHTKEKEESLFQEEAADEEAAEKVSAGKERSDEEAFTILSSTSFEVLDKESSIELPKE
DSNLQQSTVSEPDMVESFVIISKSTAVAEPQDKGEQQADVSVPIFSSFIDDTLDVSEESD
SSSDVSRKTTLTTRPYDTPRHRQKWQQQESIEIEGMSDVRNFRDGEDARTETELEEDTDS
NLSLDELEKTEDSITTESTSELKEDIEIAGTSEKTFSDERISPMSLLKEGNDKDITDKDF
ESKIEIEESETDIKSEIKNLLTTIQDIVPLTLSIKELNDIPKENINDEIPAIKEDAESKS
EIATPRKKIEKMFESVKQDDKSKTRSPSSKFEQVDLKKDKIITETIEMDKTKKIEDIEIG
KIRSKESDVSLTSKKYITKTIPSERFVKKPKKSERMKVPSPGNRKRVLDKSKEKATPSYS
QRRPRKFIDDDSVKQTESSESQKRSPQREEEQHPRKQQVFKSKFKTDKKATIPPKTGEVD
ISKTQSKYMAWYNKKREEAEKKRLEKKATDDEEQLPRWVSRNLKQTTKQREKLTVERKTP
EMTPRTKRKIKPLVNVESEQLKAIVRQGRQLRKAEGNLKEDPTIQIFARPPPASTSDTQH
RLLQHSEYKYERIPPPFYLHPPPVPHPSPQLSPERCLEMQPCGSQYEQSESDLQSENAAS
FQSGGRLRHQQLLEKKSVFDIAYSEAAPSQLRSDSTTPPS
Download sequence
Identical sequences Aech_06013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]