SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06098 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06098
Domain Number 1 Region: 556-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000111
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_06098
Sequence length 842
Comment [mRNA] locus=scaffold433:1449213:1468373:- [translate_table: standard]
Sequence
MYSELFGCSSNESFTRNIEYCNNYLVNSKYIWFRCRLVLALKGFLQQRRIMWIMSDVDMI
EFGSYYLAIKRELVKFMQVSRCIIPQANQEDLLRSFKSYSDVTMFHFTVPKEVPRATWQF
AAFMDEKYLKFGSYPVITANNEISVSTKSTKYDYDIIVTTTTIYQPKNVTVVPVYEPQPG
DWFVAAYMSYWDKKVQQQGLGHKCQYSIGAIALWSQIDNIINIPINYQMRLRTSATTTYY
KIYVPSGLLSFRLSVWNCNFTLHNFRDINKPCIEAMYLKGRVLPTSNYFHSTESKILTTN
ASYSFIESSPYEDSYYYLLIVSSSIIEFNIKIDTTECPIGLTEKSFTREYTNIIPLSFNS
ITKTSTYKELIKHRWYNEEINGSKFYNKDEFYQKNEKRDTDNQCIPRHRLVRVKHAETFS
TIYLLQGKEWLNSRLVLTDSVPMMTQFDILPLIDIGGTLDINVHLEVKKLSSTRSILVTM
CMQRDRIPTLEDRHSCQNGTLAINLSSLSKRNASLLIAYPQPGTWYIIILATCYNYGKPV
RCQIAEMSILLNIRTKKCMFSDQSPCGNHGICQEIQKNILHYATCNCFKGYTGWDCTDIS
NTVPVISLMSTILLITSNVFFVPAVYVAVKRKLYAEGLVYLITMLFSSLYHACDENGRFC
ITKYEILQYMDFFSSILAFWITLIAMAKLSITIVPLCHMTGVFVITFGVQINRMCLISIL
IPLSLGIIIPVFRHTYRTFQSRKCKKPSRKILLGLLFATTGLLLYSFIETEKNYQYVHSV
WHIIMAISLIFLLPPAKLQQKTTSSINASFDDNSESWSCKDGIYGIPTFTIIDQENGTIA
SN
Download sequence
Identical sequences F4WSZ4
Aech_06098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]