SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06214 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06214
Domain Number 1 Region: 174-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 2 Region: 40-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 137-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_06214
Sequence length 275
Comment [mRNA] locus=scaffold298:182876:186592:- [translate_table: standard]
Sequence
MNTDWWHDLLIPPTFDAINAHEHNTRHPNTAGEKDTQPECDQMTELRCRSGECVPLESRC
DGVSQCNDSSDEDNCPTDSLNKTRDDFEYTTVTSQHPSLHFPTETTHTVNPEVPDIDDKQ
TEESTLRSSSNKCRADDTVRCHDGSRYICSVQQCDGVPDCDDGGDEIDCPHPGCSAGEFA
CDVNRCILDSQRCNFVEDCQDGSDEHDCNYPEPSSFGTLFHPVRTSLIEIDGLSATRIRP
DAATLIQIGLPLVQPVGVGANFRRRVSSPNGEANP
Download sequence
Identical sequences Aech_06214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]