SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06245 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_06245
Domain Number - Region: 32-83
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000769
Family Growth factor receptor domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_06245
Sequence length 249
Comment [mRNA] locus=scaffold298:972460:977316:- [translate_table: standard]
Sequence
MTLIVSVIVVLSVLANVLLADLDPRGTRCGEILCNISQYCSPFDLHCKPCADACNATSHN
YQPDECKKDCQFYLHDQRYIQRMDQSRQYDDLREEIERLKYRFVITTILTCFSLLGMLYL
LARTLKRWKRIQESLQTIFRRNMKVKQANKNKVQDDVEAATNKQNSLKLTIPSISATVEQ
ESKIENNNSNSNSSSNSNGNNTTPNTTSTPLSRRHASEDTTLDYAYDNPAMTPSPDSAQL
KTKARESSF
Download sequence
Identical sequences F4WJQ3
XP_011054238.1.86870 XP_011054239.1.86870 Aech_06245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]