SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06415 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06415
Domain Number 1 Region: 121-458
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-85
Family Subtilases 0.000000000923
Further Details:      
 
Domain Number 2 Region: 744-903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.8e-31
Family Growth factor receptor domain 0.00085
Further Details:      
 
Domain Number 3 Region: 452-582
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-31
Family Proprotein convertase P-domain 0.0004
Further Details:      
 
Domain Number 4 Region: 991-1139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-28
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 5 Region: 895-1013
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-16
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 6 Region: 29-71
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000442
Family Prohormone convertase 1 pro-domain 0.0076
Further Details:      
 
Domain Number 7 Region: 1132-1227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000683
Family Growth factor receptor domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_06415
Sequence length 1295
Comment [mRNA] locus=scaffold485:84112:107430:+ [translate_table: standard]
Sequence
MPSKSRKRETCEHPLASSCLRLLHEDAVPIGALKNYYLFSHKRLHKRSLTASEPHHKALR
DEPRVHWFQQQHEKKRKKRDFDAASYAFADYQPFFGGFGPRPRQAGLFHRQRNRGVPLQN
LFTDPLFKEQWYLNGGAKDGYDMNLGPAWQKGYTGKGVVVSILDDGIQTNHPDLALNYDH
QASTDINDNDDDPMPRDNGDNKHGTRCAGEVAAVAFNQYCGVGVAYNASIGGVRMLDGPV
NDAVEARALGLNPDHIDIYSASWGPEDDGKTVDGPGPLARRAFIYGVTSGRKGKGSIFVW
ASGNGGRHTDSCNCDGYTNSIFTLSISSATQGGYKPWYLEECSSTLASTYSSGTPGNDKS
VATVDMDAKLRPDHICTVEHTGTSASAPLAAGIAALALEANPTLTWRDMQYLVVLTSRSE
PLSNEPGWILNGVKRKVSHKFGYGLMDAGAMVNLAEQWTNVPPQHICKSDEINEERPIDP
TYGYTLSAYMDVTGCAGSLNEVRFLEHVQCKVSLRFFPRGNLRLLLTSPMGTTSTLLFER
PRDVLSSNFDDWPFLSVHFWGEKADGILKKWQLIFYGTSTNPIRIRTRQFNPVHQSAYLP
SHSVHYPFTVDDDPLQLSGYPGNRDFFSPSTFQSYQGPFSGAASNLQASVATLDGSSAPI
LSNHLPGDVSSASAFDSPSAPSSVQADGSLDTTRRILHDCDPQCDAQGCYGKGPTQCVAC
KNYRLDNTCVSRCPPRSFPNQGGVCWPCHESCEICAGAGQDSCLSCAPAHLRVTDLAVCL
QQCPEGYYENTENSTCVPCEANCASCQDRPDKCTSCEHHLVMHENKCYAACPPYTYETQD
YNCAPCHPTCETCNGTANNQCIACRSGLFALNGTCRASCPAGYSADKKRRECVACPPGCA
TCSTLSCTSCIEGWSLNKKGLCAPESRSNCNTGQYYEDGQCKSCHSSCETCAGSTEDHCI
SCPNPLLLQGKRCVSQCDDAYYSVVQPSRPVCVPCLHTCKSCVSRLNCTACQDGLQLQSG
ECRSSCAPGYYSDRGQCAKCYLSCKTCSGPRRDQCVTCPRGWQLAAGECHPECPEGFFKS
NFGCQKCHHYCRTCKGEGPLECTSCPPHSMLEGGLCMECLGAQYYDSLTQLCKSCHSDCR
RCTGPGKFSCAACSPPLHLDKLNNQCVPCCTGNEKGSQAEQCCLCDPETGGCRNSSPAGK
RRVPGTEFSANTAVSETYNNYGETSNNDSASLAVTAATTMAVAICLASIALFAMIFVALQ
AWSGRRETNMGYTQLAVKVEPSEDVDADDSMELMT
Download sequence
Identical sequences F4WVD8
Aech_06415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]