SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06742 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06742
Domain Number 1 Region: 231-347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0068
Further Details:      
 
Weak hits

Sequence:  Aech_06742
Domain Number - Region: 908-940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0054
Further Details:      
 
Domain Number - Region: 636-729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000301
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number - Region: 47-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000366
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_06742
Sequence length 1003
Comment [mRNA] locus=scaffold110:648881:668507:+ [translate_table: standard]
Sequence
MLFAKENLRAAVTALLALCTCNKTYYGDVGKTYDLELHRPKEDKVPYICKLTFNAPGDDF
GDIVQLTFDSFTLGKFVSFTAAGCPDGSLQISEVERPDVGGLWCGTSWGPAIYYSETPSV
SIILKLLRLSKDQTGFNFDFRMAYKMIKKSDAVVRYGNPFVGITQVVGTPASTERTSAEY
ANTSMAMPVQMVEQHVPSPTKPSSEQFLGDLISGTYCSRIFTDCDRKKCRLQSPNFPGLY
PRNLTCYYAVRQHEVPAGKHALIHVKQPRGQLVAVRARPATQAEAPPRELRLWQDCDVVQ
DYVTVYDGYTTREPVILKFCGGGEPVPEAISSGPEILVEFTTSPYGTFLHPTPPHSLHGF
QLEVQVTFVDAESPTYAKNKRCEFWLRGTGGGILASPRHSLPRNSTCLYHLRGAGPTLPS
PTPPRPLPKFPEQRPGTVWRRPAPRPPQPQFRVWLSILKFHVGTSLSSTDEDCSTTLMVW
DGEMMPLSECNDVVCEKERQRYAERMGDPIQPVLARPSSNTTLLARYCKDKVPKTCDHAI
LQNTSRPCSLVESFVSSGSSLTIEMRMVESTALRQVFSFYLPVNFRAMYEFVDLHQDGDP
YGSGPCSRIFYSRTRDHYSDRKFQGPRDIFLYGRGGSKNISCVYRFEGEHDEVVKLRFNK
LLNGNRTCRSVGNSDFNRLLCVDSENFSVKVLDLPWPNAPPIQRDCLCSNRSLPINIKST
SNIAEVHFNVLSMDALDDYNNLFFEGTWDFVKTMPCMQKRRVRGPSGEIKYTPPIDDDEK
NCENQPWLIDPGPGQYLYVKMDGVIVSNNTKCATKNRIIVYTGGAIHVSVCPKPPADSSH
HVVEVFSDGWAVSSNAMILAPGQDPIRTIAVEFIIKEPASYIVTWLELTRRPSVTSTAGL
QMSRDCEQRCPELDACINASLWCDGVSHCPSGYDEALTHCSVLLQLPPLQLALGALFVIT
VLGVICFIVWRACRRRGRRSISQHRLKSISSETAIIDGKEVIC
Download sequence
Identical sequences F4W516
Aech_06742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]