SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06830 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_06830
Domain Number - Region: 183-309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_06830
Sequence length 405
Comment [mRNA] locus=scaffold686:603630:615278:+ [translate_table: standard]
Sequence
MKPANMRMCVLLVHVVLVAITLANGDKIDIPIPCRNTSDCRNMSLPGDAFCQKGYCMCPR
LDNDAEACSSINTSMHENKTSGSLLYRRCKHEQDCLFEGGICNYTISQCTCLKNYVPSSN
LKSCVQKIDSFEVSCTDKNQCLAFLANTTCENSTCICISGYYHIDNACWKMAGYAEPCTK
NQECSHIEGNICTDNKTCGCAAETVLNTNGTKCLTAAKKIQDECTESVQCTFEFSACVNN
VCQCREDFHYEREMTRCFPNKAIGNECVDNYECYQAEDYKNDPPVKSMTCDSNICTCADN
YILNVEDKCISKSAGSSLMMSLSILVCVISLTKILLLHDCRRRRQIIRRNGGKVEKPVEE
ASSEGTTEHCTVNRFASLCGVQSPAHIAIASIYFVDVMPKVPKDK
Download sequence
Identical sequences F4X390
Aech_06830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]