SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07114 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_07114
Domain Number - Region: 66-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00349
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_07114
Sequence length 158
Comment [mRNA] locus=scaffold115:580800:584395:- [translate_table: standard]
Sequence
MRPDDTDSFCAGSVSVGKMPSLLYDREHKISLLSVNVAAVTRMLIRYVTSKGSLAHLQSI
RRSGYRFRCRCPSEFTPRITEGVCQCNCFENNENCIKTRRGKGYFSLADRICIQNNECAM
PNCEFGEYIKWQGKCPRKRDTFDAMTSYRANLSHRFRS
Download sequence
Identical sequences F4W5E1
Aech_07114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]