SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07141 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07141
Domain Number 1 Region: 59-193
Classification Level Classification E-value
Superfamily Cadherin-like 7.86e-23
Family Cadherin 0.0076
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000563
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_07141
Sequence length 245
Comment [mRNA] locus=scaffold115:1262837:1272100:- [translate_table: standard]
Sequence
MVNYTLAGGRVENEQLLVRSDTGDICIRSPLDRETVPYLELPVIATDRGGLSTIAIVGIQ
VTDVNDNRPIFKPQRYNVTLRNDDVTRSSILKLVATDLDVSVFGHVTYHISSGNEDEIFQ
IDRNTGELHVARPGLLSRLSLHHINVTATDAAGLKSIVDAEVKVTVSTAEHRIATCEKPR
YTVSVKENIPQNSVVSGVNSTTASSSSTGYLHTGVNLAGLLERRYNPRPANASETYSTRG
VIALA
Download sequence
Identical sequences F4W5G5
Aech_07141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]