SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07177 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_07177
Domain Number - Region: 214-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0719
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 74-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0837
Family Spermadhesin, CUB domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_07177
Sequence length 357
Comment [mRNA] locus=scaffold29:303981:305791:+ [translate_table: standard]
Sequence
MARDAGVVYLLIVIAHLCSCARYDSYDYNHYVEYSLENEKICHVLNKKHMLDMQHGAAAI
VMPHHMFDHWVVKANRNCTFVFRTGKNEGLFAVIQKMFLRRDGDRCVDYIRFKRSDGFYT
NKFCGEIDRSQTTYLPVPEPEDNLGNINDSRSPNYDIYAEYDPVKKSKLWSIRSDSATIE
TEIFISKERVPDGQSLDLTIVYTPYMKCDQANSEHYQAVGYNNCIRKEYICDKVYNCPFS
ICSDEVNCVNDRYPKNNTATKVTVGAVTTMILCFIIFILCLWICKKSQKLCWSSDCAGPN
VCSRPVSLPDADGAQGSNRAVPTAPMLEVAMSSPVVDKDLPPSYDSLFPEQSNPARS
Download sequence
Identical sequences F4WIS1
Aech_07177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]