SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07253 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07253
Domain Number 1 Region: 33-155
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-34
Family Astacin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_07253
Sequence length 164
Comment [mRNA] locus=scaffold367:99934:100704:- [translate_table: standard]
Sequence
MNVNPDELGDYFEGDIMIASDIKRNVLSDDADWHWWSDGVIPIVVDGDFDEKGHEHIHQA
INEFKKYTCIEVKARTNEDNYVKISSDYSGCWSEIGRKGGEQKMNLQIPECLGKGVIMHQ
FMHVAGFSHEHTRSDRDNYVKINWENIQEGIYSNNKSLKGLIFF
Download sequence
Identical sequences F4WQ31
Aech_07253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]