SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07318 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07318
Domain Number 1 Region: 1792-2118
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-19
Family NHL repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  Aech_07318
Domain Number - Region: 1484-1562
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000373
Family Pre-dockerin domain 0.062
Further Details:      
 
Domain Number - Region: 1234-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Integrin beta EGF-like domains 0.097
Further Details:      
 
Domain Number - Region: 2025-2277
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.00235
Family Putative isomerase YbhE 0.035
Further Details:      
 
Domain Number - Region: 1203-1226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 1334-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 2776-2822,2865-2995
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0188
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number - Region: 1167-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 1138-1162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0963
Family Integrin beta EGF-like domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_07318
Sequence length 3373
Comment [mRNA] locus=scaffold367:1395390:1419982:+ [translate_table: standard]
Sequence
MSRLNGRLPGSHAASDHERDPDLEPSCLVRTPSGNFYNIPKIPKNEYNNKNQSTGNSPIK
VELQNNMDRVPLPYGHAPSMIPMRRQSIRCHFRKGIDWCSWKLIAIVVIMLSLCLTAALT
YVAVNWSYQGTKACSVLVGENTDAKPSSGEANKTSTSSTSTSSQSSGRTRPQSSSGGSIS
TSDSMLLDGVVYNRKRRDTFNEHALHQTVAPSSSRDPEELSLTTVAEAETSGFGQRSVSL
HEESSGKVVHDPEHVDGQSPVRGAIDRSIKATKDAPPESSGSTAPSRVIQLVVNVSSTAT
NYSHDHSIHTTVAVDHLASSSSVSVGSGNSLASASVRQSPHNETSSTTSRSSQDTSAKYI
PKFVAADGNVHVASKAPVTKLSRDDSTDFDRDIDNAGTSESSDFVESSGGIEATTSASGS
ESTKLGADSSDYSQVVGGTAENSRNVFPVDYSDNIDDSIVEPTTVTEIRLNELGSEDQQS
NVSNSNSSGELVPVEMNREEIDASTVLPSTTTDKITLNTLSSKDKNVEKFEDVAEAENRD
DVFEEKINSDENERSIIFERNNSNSNIITNSESFNIVKEMRELSREFSSSEFVASSNLAK
TSEQSEELQQDYPVPIYSYGQDDVEIVDLHDKKQPVETAKAELPAKSPESIPILNNDVKM
NAALRQKWNKDNIQIIEREKNDEEFLRKFKKQFHEASTANESVENSPSIKTNYNSPLTDT
LHETMHDSLGNASPRFPSQSDPPVIQRVQIIEVPVYRDPSQPSSSSSSFSSSSHRVLINV
TIATEDSSAVSSKPLYVLSVSVPTESGAISHSSGINVDQAQMRTAEQLSEPSAASMKKIP
VNDNESINAVDTRLPPPPQPPASPPAPIWAGGECECSCPCMGSSSDEWDNFSAIDDDDFE
EELESVNSTLLAENSPEEPGERLTDKRDGELSSKDSVRPDATSTTEDYYPFSTDTAESSE
STNETSASTYEPEVSTDAWSCSGSTPLPPEPTILILEGARTFPARSFPPDGTTFAQVGLG
QKLSKEIPPYGYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG
FKARTTRASHPSIKKEVTKYMEPGHWFLSLYNDDGDPHEVSFIAVIAEDMTHNCPNGCSG
KGECLLGHCQCKPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEV
PDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQM
DKEALQCLPDCSGHGNFDLETQTCVCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPG
WSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVSNDAQW
ECQCYNGWDGKDCSVLLEQNCSDGRDNDKDGLIDCADPECCSNHICHSSQLCVSAPKPID
ILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESRSAVIRGRVVTHLGTGLMGVR
VSTSTPLEGFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIIM
STAEEKPPIHVPHACAAHDYDLMKPVVLATWKHGFQGACPDKSAILAESQVIQESLQIPG
TGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLNLIHLRITIEGILFEKIFEADPVIKFTY
AWNRLNVYRQRVYGVTTAMVKVGYEYSDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHH
RYNFHEGILQKGDGSNIYLKHKPRVILTTMGDGHQRPLECYDCDGQASKQRLLAPVALAT
AADGSIFVGDFNLVRKILVDGTVRTVVRLNATRVSYRYHIALSPLDGVLYISDPESHQII
RVRDTNDYTDPDHNWETVVGSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYF
ADGTNIRMVDRDGIITTVIGNHMHKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLH
MIDDHMVLQLAPDGRVKVVAGRPLHCASPSASFDTELATHATLVMPQSVAFGPSGDLYIA
ESDSQRINRVRVIGTDGKISPYAGAESKCNCLERGCDCFEADHYLASTSKFNTISAVAVS
PDGVVHIGDQANYRIRSVTASIPDASGAREYEIYAPDTQEIYVFNRFGQHISTRNILTGE
IVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHE
LSTPDDYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSL
KGAVVKVGQNNRKPISMLIKGSSVVTKIGEAEQRTTVLADGSVGRVTPWAHTVSTDSMPY
SILAELEPLLGESYPVPAKQRTEIAGDLANRFEWRYFLRKVQGNKNRGNSKAIAQVGRKL
RVNGEILLSLEYDRETNTVAVFMDDRVELLNVTYDRTARPVKWGPRNGIFAGVELEYDRF
SRLTSWTWGDISETYGFDRSGRLYEIKYSDGTSMVYAFKDMFSILPLKVTTPRGSDYLLQ
YDEAGALQSLTTPRGHIHTFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQ
SGKVAYVYDHAGKLETTLAGLSSIHYTYQETTSLVRSIDINEPNFEMRIEYKYHAGIVKD
EKIKFGSKSGMDNAHYRYQYDGNARISGIEVDINGKQLPQLRLKYNQNLGVLEGVGDLRI
YRNLFNRSVMQDSSKQFFTVTDYDEHGRIKTVLMNIRSFDVFRMELEYDNRNRIKMRKLT
IGKESMEKKEWSRMEKITYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIVLGYD
SGDRVVQYGDVEFNSYDGRGFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLV
SMNDDRENITQFFYANPKTPDLITHVHFPKSSKTFRFLYDSRDFLMTVETSEQRFYIATD
QNGSPLALFDTNGNLIKEMRRTPFGKIIKDTNPDFYLPIDFHGGLFDPNTKLIYLNKRLY
DPTVGQWMTPAWEQMANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLGSWLKLYGYDIS
MMLGSEYTKQMVYQPSATVTSPQLTPDFGVMSGLQCIVNRVQEKFSDLGFVPKPLLKLEP
KTRNLLPRVAHRRAVFGEGILVSRVGGRALVSVVDGVNSVVQDVVTSVFNNSYFLPLHFS
VHDQDVFYFVKDNALKIRDDMEELHRLGSMFNVSTHETTEHGAGTWKELRLHNPDAAVVI
KYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELMSRGTVDGY
EGVDIHSVHRYPQLADDPGNVAFTRDTKRXXXXXXXXXXXXXXXXAATGATGLTDTIRDS
RTPRREFKVSLGT
Download sequence
Identical sequences F4WQ11
Aech_07318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]