SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07428 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07428
Domain Number 1 Region: 232-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000154
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 2 Region: 87-244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000204
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 3 Region: 380-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000366
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_07428
Sequence length 497
Comment [mRNA] locus=scaffold447:159874:163205:+ [translate_table: standard]
Sequence
MQRLPICLIVFTCLGVGTWAIEGVKGGHRPRYPTSGSYSNINSSQNGLCHKRVPYSHVLA
LNASGSLYNTIPQAPEGGHPPDGWITILDCCDGYVRNVTSGLCEPQCERGCFGGRCTAPN
VCSCPSGWRSEDGVCMPVCSYRCQENAYCFSPEVCVCKLGYDEINGQCKPICPDGCKQGE
CVAPRVCSCRQGYVLNERKECVAACEGGCVHGVCSAPGVCTCDEGYTNFLGDTESCIPHC
PTSCPNGECVAPNLCSCKNGFTRNQTGACIPICPGGCEGGECIAPNFCSCRPGYTQDRHN
GKCVPSTGSAQCGYGYTVDPDTRRCIPVTTTPTSQPVGDCRYGCGPHSMCVEYRCICEPG
FTVDPDTGRCISVTTPTTNSTQCRYGCGPNGRCIGSNLCVCDPGFRVDPDTGRCIPHVST
SADMCQYPCLNGRCTGPDQCTCNHGYTHNEYDRTRSRCVPVCVGGCPNGVCTLPNFCICN
PGYRKEGVKGRQRCIPE
Download sequence
Identical sequences F4WTV3
XP_011059668.1.86870 Aech_07428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]