SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07429 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07429
Domain Number 1 Region: 957-1121
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000597
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number 2 Region: 854-980
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000345
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  Aech_07429
Domain Number - Region: 1367-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 167-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0149
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number - Region: 1216-1338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0549
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number - Region: 549-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0942
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_07429
Sequence length 1545
Comment [mRNA] locus=scaffold447:164453:176244:+ [translate_table: standard]
Sequence
MKLLYVIFILAILQDELIIKVELHTETLSSDYSTGNCSKIVSFMETSEVPYLETFKEKTW
GIFYKTRVRWNYKIESRKSWRMEYECCDGFERKLFWDASNMKIYAKCEPFCRPPCGNGTC
TKPNLCICNYGYIFTYSETSKSDVSCVPVCTPPCVHGKCVLPDTCMCDSGYKSTNDHYIC
EPICNVPCPTGSYCYKPDQCLCLNGYKNISNDVKLTNMCEPICERECVHGKCIAPNICTC
DDGYEPDTHDLFACKPTCEYGCLYGECTAPNVCTCNEGYSLNTSSVCEPICSEACVMGTC
VAPESCSCFVGYGLENSNYICEPVCEKACLNGRCTAPGTCMCNEGFQLSGDETEEHICKP
YCETSCEPFGVCTAPNVCSCFEGYRLANKMQIEKINLLHFASSSVCEPICEIECINGFCS
APWTCSCNIGYHPTSTISMSSPYVCQPICSQKCFNGFCTAPETCMCDSGYRRSNSWNECE
PICETDCINGYCTAPNECTCNSGYQPTEGNRTSLCEPICNPSCKNGICVQPDACSCNPGY
RLSMNSKTVCDPICHPACGTNGICEAPDLCVCKDGYRMVYYDRKNVPFRCEPICSIECGN
GTCTAPDLCMCFDGYRNAEIGGCEPICSICNNGRCVAPEICECNDGFVPADPNLEFGVKD
SRSPIVSENRTKNESRCLPYCENCDNGECEAPGECRCYAGFVKIEGTCVHACQGDCSTHG
ECVEERRTCECDYGWTGLHCDRPTLCVLILKNEDNRTDQLRIIKEKNATIEHILKNNPTC
SECIGKVNNETLCFKMFGNDTEDEAEIGCLMNEVYIQKIPIYIPYKETYRSPEQNMSEKI
RDNFRIEFRIIRTCSCEGYVVSGTDRCVPRCPQSCKKGTCKEPDVCTCNKGYRMSSKDKQ
CMPECTSGCINGTCIDPEVCSCNENYWLDSDGFTCRPVCNAECEQNYGYCSEPNVCICNK
GYRVSNDSKCMPECKNGCINGTCVLPNICTCNEGYRLDLDGFTCRPFCNMKCENGYCSEP
NVCTCNSGYRRVGNDSSPFMCEPACNSDCERKKDSCATDPDLCVKINCSPDFELDMNHRC
KPKCHSCIFGTCTASGTCTCDHGYTIVNGSVCKPICEPSCGTGICTKPGLCTCDFGYVFD
ETNRMCKPHCSVPCGLNKECVAPNECKCSKGYHKKDIIFNLDHPHFWHPLFRNEFSLRRS
FFKKASIALVFYCTPICNFECINGKCTAPNVCTCNRNFYPRWIDHHPSLPDNSHELRICD
HLPGPPCNESSCGVKGTCHESGICICNDGYVRDTNGDCVPFCAPMCSNGTCTAPNRCECH
DGFASRNESFCEPICEKGCKNGDCIGPNECICHDDFISNLNHHLGPECIPECTRNCSEHG
NCVVDRIDNIDITYKCTCHRGWTGQDCDQSTMCMMLMLDNYEDLNSTTIRNDSTIDVPFF
EDMSYCECNKSIDNETLCFKQYEGNTSFISCLFNKDLPCYTTSYYNASINGAKIVWSFVI
VTILVATSLTAAAYFVYRKRQKEKFAGPSVHVFMRESFSTEILLQ
Download sequence
Identical sequences F4WTV4
Aech_07429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]