SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08085 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08085
Domain Number 1 Region: 486-537,577-702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-23
Family Laminin G-like module 0.00085
Further Details:      
 
Domain Number 2 Region: 220-332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-16
Family Laminin G-like module 0.0098
Further Details:      
 
Domain Number 3 Region: 85-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 462-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.028
Further Details:      
 
Domain Number 5 Region: 138-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  Aech_08085
Domain Number - Region: 442-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000175
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_08085
Sequence length 713
Comment [mRNA] locus=scaffold56:2300633:2317372:+ [translate_table: standard]
Sequence
MEVKPCNGDPPLVDSEGKEYDCGSGPERKDCPSNSYCHQTTRFARCCKKVHGIQVVKCAD
SWHGCCPDGKTAALGPDGAGCPSLCGCNRLGSVSDTCNPETGQCECKPGVGGLKCDRCMP
GYWGLPKISEGHQGCIPCGCSLFGSVREDCEQMTGRCVCKPDIQGQKCTICNDHNKILTS
TGCYSANYVPVTPTQEFRACLSYPCHMTSTCIDLPSATFVCICRPNYTGLLCDEEINKRD
YEIPSFDGKSYVRMNRLKAYHKFSIEVEFKTYADNGIILYNQQKNDGSGDFVSLAIVDGV
YDNIGTNHGLLGCIRKLKINRNNIDLHVGHDRDVLESYRVKECGDNACANLPCQNGATCQ
PIFEEDLCNGRDCRRLQKRGKNKNRGGNGKSGGVNIVRCKGSHCTSIDQKRTKKNARRGE
YVSELQYDKNYDHGNYAVEKYDPPDYRCICPPQFTGRNCEESLDPCVGEPCQNGATCDIL
PQGGYVCKCPPSRTGEHCEILMGYDVSGTEISERPVRFEGDNFLQFKHRYGRSTNSTNTT
LGEYFEESYSDYDLEEDDDYEYDNYDYTERRGQQSNKFELRLRTIHPDGLIAWVGRGKLE
HLFLSLHDGHVVLTYKSKIDEEISVKSKERVDDGVFHHIRASRRRKACTIQIDENMPVKV
SMETTLLTTNGKVFVGGKPGHRGIKGCVTDFIVDKRRLQLTRRKIDFCHDNDV
Download sequence
Identical sequences F4WZ61
Aech_08085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]