SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08111 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08111
Domain Number 1 Region: 157-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000742
Family Growth factor receptor domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_08111
Sequence length 359
Comment [mRNA] locus=scaffold274:343431:344830:- [translate_table: standard]
Sequence
MSSIQCEKGKLGEEELKSQKFPPCAACKVFTNSFKKGLEKTSRGKFEGGDSAWEEDKLGT
YSRSEIRLIEIQENLCKDVERGQVQCQSLAEELENQIEEWWFKHQDTHPDIYDYICIEKT
ERCCPKDHYGPNCTQCPGYPDNICNNNGKCKGAGTRKGNGGCFCEKGYIGDICSECASGY
YESYKDEKTLLCSVCHTACDGPCRGAGPKDCEKCTAGWDMIENKGCFDINECLKDDICPS
NQFCVNKEGNYACLACDKACNSCTGDGPDMCIRCTEGYHKQDNLCINSDLLGRKKQENLA
RYLTYFGLCVATCIILQRNIYVASIIGLLVAMYISVSEYMIAHSNVQDTTTNMDILGPA
Download sequence
Identical sequences F4WHH2
Aech_08111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]