SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08228 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08228
Domain Number 1 Region: 104-242
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-24
Family C-type lectin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_08228
Sequence length 390
Comment [mRNA] locus=scaffold289:1067306:1074765:- [translate_table: standard]
Sequence
MEAAASVGHEPPPKNGPHRPDRRIVWVYSIGHDRDIYDLDKKRTKGAKVRSFFLLRAILR
LYETADYQYVKLKARQGLSSAVLEAPNFDISPLTNQSITLRQHESVRRFACPVGFFRLKR
FCYYLSAGTAPWREAYFHCKDRNATLAILDRNGKDKMLRKYLMGDQFTKLERWIGGIFNW
QQMAWEWGVTGEKMVFQSFGKMEPGRSKKYAWHCIVMDPVLKYKWSARSCMERKHYICEV
PAGRLARRRKKSQDPFAPQNQRLKPRKKGKKYLDEQRKSGERKKNRSNSRRNWLDQRENQ
QWAHGVKLGSRPPSNTKMIPKERTRHHSNRTRVQSTVPRVAQVLPRGREYGAFLANGYHQ
SQNLADMDNVLSQFHNKINDFAREEILLKP
Download sequence
Identical sequences F4WIN9
Aech_08228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]