SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08282 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08282
Domain Number 1 Region: 277-560
Classification Level Classification E-value
Superfamily Kelch motif 1.05e-80
Family Kelch motif 0.00000134
Further Details:      
 
Domain Number 2 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 7.46e-32
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_08282
Sequence length 568
Comment [mRNA] locus=scaffold507:812271:815305:- [translate_table: standard]
Sequence
MSCVSISPKHAESSLRVMESYLHKQQLTDVTLIAGNKRVPAHRLVLSAGSEYFAAMFTSS
LRESAQNEIELMDVDGDALWALVLYCYTGCIELQEDSVETLLATACLLQLNPVIKACCQF
LIKQLHPSNCLGIRMFADTQGCSELFEHAHAYTTKHFMEVTKNQEFLLLSANEVAKLLES
EDLNVPSEETIFYALVTWLEHDPENRSKDASTLLGLVKLPLLSPAFIADNIESNEMFKDQ
RMAQELVMEALKYHLLPERRPLLQTGRTKPRKATVGTLLAVGGMDANKGATSIDAFSLRD
NAWRSLAAMSSRRLQFGAVIVDKKLIVAGGRDGLKTLNTVECFDFSTLAWSTLPPMNVHR
HGLGVAVLGGPLYAIGGHDGWSFLDAVERWDPATRQWSSICPMSIQRSTVGVAVLNDKLY
AVGGRDISSCLNTVECYDPHTNKWTPCAPMSKRRGGVGVGVVNGCLYALGGHDAPASNPN
ASRFDCVERYDPKTDTWTMVAPMSVPRDAVGVCVLGDRLMAIGGYDGQQYLTLVEAYDPH
LNEWESVAPLKAGRAGPCVVVKNLTNTV
Download sequence
Identical sequences F4WWQ1
Aech_08282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]