SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08321 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_08321
Domain Number - Region: 628-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number - Region: 509-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 205-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_08321
Sequence length 962
Comment [mRNA] locus=scaffold436:30028:38135:+ [translate_table: standard]
Sequence
MEYRFRYTITVKVSEQKPYTVRENTWCLSFPPRCSKYKVVYRTVYKEQELIKQKPVEECC
KGYTETTNGSRCIPVCSEDCRHGTCIAPDICKCESGYGGPLCDFKCPSGKWGRDCEMDCK
CQNGAACDPFDGKCMCTRGWTGVYCDQKCLFNRYGQDCAEECRCSNGGSCHHISGECHCT
SGYTGPLCNDLCPVGKHGEECKSECRCQNGGSCNPMTGECYCTPGWTGSVCANRCPEGFW
GKNCSQSCDCYNGAGCNHITGKCQCKPGFYDDKCLKICPEGTFGLNCTNNCTCENGATCN
PTNGTCVCSLGWTGKTCKQRACEDGLYGPNCAKVCECENDKTELCHPWTGYCSCKMGWDG
ETCARPCPLYTYGKDCQNRCNCRNNAQCSPINGTCICAAGYRGKDCGELCPANTFGEDCA
QKCACKNGASCSAENGRCNCTAGWVGVLCDRPCDDKSYGKDCEDKCKCFNNAACNPQNGT
CTCAAGFTGILCQDRCKMGFFGNGCNQSCDCVEENTVDCDSATGHCICKPERRGVRCETK
CLEGLYGEDCHSHCECMNNSSCDPVTGSCVCARGWQGPDCSQPCKEGWYGLGCREKCPEK
MNGNMTCDHVTGEYVCRPGYLGLTCEHPCPPNRYGLNCANRCHCVCQCRPGWQGEYCQIP
CAEGTYGVNCTQHCKCQNGGKCRSNDGHCRCSPGWTGTRCTEICPEGYYGDHCMESCECK
NDFFMCHPAEGCICRHGYTGENCDEQLFSRNIQEKKDGGYGHIVGAIFATIVIIGILFAA
WMYHRRRVADLKSEIAQVQYTAEPVSPPDRNQFDNPVYAYQGSSKFDDGTTTLLNNFRNN
FHKNINTEKAKFGLGSCTDDEDDCKGAYGLQYDLKNRDADMGNPNLNVYHSIDEMDGKKV
EHVYDEIKQNNESEYDELNQPRPVSWNIKPHSSRTANGFLPKSCDNPGPSKVIDKDPELG
DT
Download sequence
Identical sequences F4WTC6
Aech_08321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]