SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08393 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08393
Domain Number 1 Region: 488-614
Classification Level Classification E-value
Superfamily Cadherin-like 3e-27
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 394-500
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 712-816
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 599-692
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 291-390
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000228
Family Cadherin 0.0042
Further Details:      
 
Domain Number 6 Region: 934-1050
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000228
Family Cadherin 0.0026
Further Details:      
 
Domain Number 7 Region: 79-175
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000343
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 830-941
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000814
Family Cadherin 0.0083
Further Details:      
 
Domain Number 9 Region: 178-290
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000771
Family Cadherin 0.0034
Further Details:      
 
Weak hits

Sequence:  Aech_08393
Domain Number - Region: 1543-1603,1648-1661
Classification Level Classification E-value
Superfamily Tetraspanin 0.000248
Family Tetraspanin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_08393
Sequence length 1715
Comment [mRNA] locus=scaffold436:803705:821352:+ [translate_table: standard]
Sequence
MRKIQNANSLQLKSLEVNLHLPRCFILQIIWLQDRARNVSERFTSTTTLTVNIRDDDDQD
PSFIYQGCMLLDGACINPEYSASVSSGVLSGILNISPEKIQAVDMDSINAPIHYSFLSGN
PPNYRDFFEINPNTGAVKQVKAVDTTVTKKFDIIIKAVEVSETKRSATAKLAITVKPVDS
NPPVITASNIEGFVDENAPIGTKVIDKSGNPIVLTVSDADLGPDDPKPAYTFELTTNFFA
IDPSGILVVNEENLDRDPPSPGRFRFQVVAREKTGVAASSPLSFVVTLNDVNDNAPLLPM
MAPITVQAGETKRQIAKVEATDNDEGENAEITYSIYHVSNNGLHKFKIDPKTGVIESVRK
LNAGEQYSITVQATDKGGKYSQTIVEVNVIPGPNTRSPVFQQPVYEVQVSEGASINSTVA
TITATDPENDPVSYSIVSGNDLRQFAIGDKSGVITVIRKLDREDLTRYQLLIKAEDTGGL
YSTATVNIMVTDINDKNPEFVGLPYEFTVKENEARKLIGRVHAEDADEGINAEITYFVPD
DIPFTVDPETGDVLTKIVLDYEQNDEYKFVVTARDGAPDYRLATATVTVKVIDVEDEVPV
FHQSSYEARVKENVPDHNVIQVTADDPDTKKQITYMIKQGDTELFSIDSKTGVIKTIRGL
DYESQNQHVLIIGTEENTSDLLGSTTRVVINVQLYFLTRWINNVLNVSWQDVNDIPPVFT
SVPRPITLDDDVPIGTTVIDLVAADSDGTAPGNQVRYDIIGRGIASKYFVIDPDTGVLRV
RDDLRKETDSEYQIDVLAYDMGDPPLSSETTVTVYVRHVATVPPEIGLGFAENSYNVEVP
EDAGDNTLIKIITIINSHAYNTTPLRCEIYSGNEEGLFEANVTKERNCALRLKKGALDYE
TTESYQIKIKLESLSGLLNSGRNTTMVKIQVLDVNDNKPEFIFPEASQKLTRGRYFAAIP
RTAQFASTVIQVKAIDKDNGKYGKLEYKILEGRGSDYFTIDGSTGIIRTTATFDHVDTSE
LPFKFDVRVRDNPNSIDNYNSIIAPVIVNLIGEENLMILVVQDAAPDVLQKEADKIANVI
QQTKNGTIETFPQDSDVWFYAIDPDTEAILNRNSTKVQRSIMDKSAMSNITFDVSTLVRA
NAIDIHAPVMPPEPVRTQTAVAFSGEVFPYALIIIACVILILGIAGIIYICVSWSKYKAY
KERMQRMYVVPRYDPVYVEPNLKEYETQVLQMSVPVDDNDSCNDLQLDFSNKNHAFSLDN
VSYITKDHGDSTGQQSPVSSEAATTARASSIVGNHGDTNIHSLRRSTLGRKNHSASNTNT
LNNRDATPVLNPLYNHGGDLLSPSPSNDNVTFRERKDYSHLGFTYLGEQSPVETTTELRV
RSPIRDANSSGRANSERPNDRTEMTYHKGIANHLNNRKFIAFSFRQLAGCTVLVIGAWLL
LEPSKGHILNLFVSDIKPHETINLIAYSLLGLGFIVLTVGFFGCRAALRGNQCILATYMS
MLIALIITELVTAAIGGLMTFQILSDLEERLSNKLSMEYGHDSTSDLPFSHSLDFAQYKF
NCCGIYGDDDYNGTAWWRDGQISGNKRQVPLTCCVLKNSENKNTGSSPMSVVSRVFHKNL
NEKPWLHPQPKDEAACQVEDEEGHEGYRHKEGCLGKVTNWLQCESFTLVFLGMAMAGIQV
NLFIIFCKLLEETILKKRKIKESYTIKNKMLILIL
Download sequence
Identical sequences Aech_08393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]