SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08472 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08472
Domain Number 1 Region: 121-239
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-22
Family C-type lectin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_08472
Sequence length 253
Comment [mRNA] locus=scaffold18:4861:6404:+ [translate_table: standard]
Sequence
MYVAYLAICDRCCLINRHELPQYNLIKTNLRSRQPIISRRVVSHVNECKKFVASKKALAF
NFVSARNRTGGQENSCQALQCPEDQNMMTLVPETNCKYYSMYPVLSPPVNATIECIPKAG
MFLFSSEVLNYTEARSFCQKRNASLAHVISEERTEGLGKLMSQNFSRFVGLSSERNERIW
KNEFGESLSCFDYRAWGEGQPSHSKGCVALTNPSAKSLSPFWKVMPCHALLPFICEISPL
SRETSKRRYENHT
Download sequence
Identical sequences F4WB24
Aech_08472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]