SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08864 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08864
Domain Number 1 Region: 1026-1093,1131-1217,1269-1374
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.54e-16
Family All0351-like 0.032
Further Details:      
 
Domain Number 2 Region: 695-767
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000706
Family Carboxypeptidase regulatory domain 0.091
Further Details:      
 
Weak hits

Sequence:  Aech_08864
Domain Number - Region: 394-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 363-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000356
Family Integrin beta EGF-like domains 0.085
Further Details:      
 
Domain Number - Region: 493-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 522-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00942
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 298-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0178
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number - Region: 462-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 327-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_08864
Sequence length 2615
Comment [mRNA] locus=scaffold174:648557:682647:+ [translate_table: standard]
Sequence
MVMPGFPLRAAAVPHYSPYSPSRFHIDKRCQHRCSWKCFSIALILLAVALTAMLAYFAAV
SSMRPIDSTNCILVQDIKAVTHENAHIHDSISTQIPTEESLPTSTAEHSSAADSAGDQQS
DPQIQQSAQQWPAVLELQAYNVAHSAIIQPYHFWNTEFRNKQPAFIRLNLTLPWGANFAV
YGRRNVAPSVTQYDFVEFVKGGRVVHRLKRDITAVSFMQSTSPQDIHVERVPQPVALYQH
VLIKRTIVEPLMVNVSLLQYFDTGDWFLSVYNDELQPYKVTLVVTEAEGVSTTCPNDCSG
RGSCYLGKCDCIDGYQGADCSKSVCPVLCSSHGQYGGGVCHCEEGWKGAECDIPLGDCQV
PDCNQHGQCVRGSCVCNPGWKGNFCDEPDCSDPNCSGHGACVSGKCYCKAGWQGERCNQV
DQQVYQCLPGCSDHGTYDLESAACVCEEHWTGVDCSQPSCGLDCGLHGSCEQGRCKCHDD
WTGTKCDQKPCDLRCAEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGLCTLQDGEYS
CECSTGWAGRDCSIRLELECNDYVDNDEDGMMDCSDSECCSHEACSEHIMCLASNNPVDV
LLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYTESPGPRSMPMESPLVVGPGDPFDP
GYTELIRVSLGLLHQGTRAKGGVMGHNPRRVAVMRGQVVTEQGLGIVGIRVSVDRDSRFG
FTLTRTDGWFDVLVNGGGAVTLQFQRSPFKPLTRTVFVPWNQIVVLPPVVMILSKEGESY
KSNQPPSPAVGFPGISMGLFSEHGPCLEHDHETLRPIIVSTWMPEKVGGLPGKSLVFAES
QIVQESIAIPGSNLHLMYQSSQAAGYLSTVRMQLTGPFIPKSLTHVHVHVEIEGSLHTKT
YEADPNLTHTFAWNKRNVYKQKVYGVAQARISIGYQHSTCPSVIWETQTATLQGFDVDIS
DIGGWGLDIHHHYNFHEGILQKGDGSTLHFKQYPRTVKVVMGTGLQRSLVCQNCDGLAKD
ARLLTPVALASGPDGSIYVGDFNLVRRITPEGKVYTVLILSATQVAYQYYLCISPADGHL
YISDPEKHQILKALSLEQVQDPSINIEPVVGSGERCIPGDEGHCGDEGPAIHAKLAHPKG
IAIAADKTMYIADGTNIRAVDPRGIIHTLVGHHGHHNHWSPAPCIGAIPAHQAQLQWPTG
LTLSPLDGSLHFIDDRLVLKLTSDLKVRVVAGTPLHCTSNANNNNGNDELPKLNSSLTTN
LKKSDEVLGSVLAVGFSPTGELYIADRDSHRVNSIRIVDSSGKMSHFAGQQQERLRGQCE
CNNTTPSTKDLDTCTCTDDTSSTETLLSSNAKFTAISALAVSPDGVLHVADQGSLHILAL
QPYLPNHDENGEFRIPFPPSNEIYVFNRYGQHISTKDLTSGKTRYSFLYSKNTSFGKLST
VTDSAGNKIQFLRDYSSVVSSIENTQDHKSELKISAVGFLEKLSERGRAEIALGYDGSTG
LLTSRSGGDETYIYNYDSLGRVTDVILPTGEKLKLLSDLSDNEGLLVKVSAPLQALSKGD
KQRIVEFEMKNEKSKMLTVTDGTKLMKAIAFTNSSLEVLLPGGGRVLSAATTKHPLLKPA
LPVEAEMLPMWSYQLMSLGELTNTMTTTYNLVGEVSHPQQTLNREIWVNDTRVISVEFEQ
AFSRETFYDKAGTPLLTVTFDLAGLPLLWQPYEQGHNLSITYDRFNRIDSWKWGASDESY
AYDRHGQLAEITNSKDGTKRYTYNDFNMLSKITLASNRQFSLQYDDDGGLRHIILPSETK
HSFSCQASLGFLRVTYTPPGSTRAYLQHYSHEGNLLQTVFPGDGARIVYRYHTSGQLAEV
VHGDGKSEIRYTESGLPSEVIHSERDVEYKWDYQYSAGLLVEERIDFGAKTGLSNAKFTF
EYDSNFRLIAVQGRIGGQTLPPHTMAYSPRSGTLEQIGQFKVTRPQSNETTVFDGTALFS
RTTDDRFLETQVTVTIHRMEVFRMEFTHDSRGRINQTRTYTRNVAVNTYTNVKNYTWDCD
GQLTGVEAQEPWGFKYDANGNMLSLTYRGNTIPMEYNAMDRIVKFGEGLYKYDNRGLVVQ
NAREERFNYNAKGLLVRATKRGRFDVRYYYDHLDRLATRKDNYGNVTQFFYNNQKRPHEV
SQIYSPRDGKLMSLVYDDRGHLIYAQVYRHKYYIATDQCGTPIMIFNQYGEGIREIMRSP
YGHIVYDSNPYLYLPVDFCGGLLDQVTSLVHMPNGKVYDPLIGQWMSPLWENVLDRVDKP
THLHLYRFNGNDPIDVRHTDRPSQPTDHISWLSHLGYDLKSLAPQLFPDELPESLVPRAL
GPGTSIFGKKKRTRNLGVQSGFLAHIAQRHSGDAVSLSAPPRSALKKDTSELIPSRLGAA
SDPPFGKGILVSRTADGQAVVSSVPSANAIYGDVFTSVFNRSYFLPFTFVVHSAQQDAFY
FVKEETWRASEDRGQLKRLGGQVNTTFHENENGSGSSSLIDVKIHGASYVVNLRYGTTAE
KEKQRLLHHAKATAIRKAWHREREALKTNTPTSVEWMVAEQDEILKVGLASNYEGEYEDP
YNIRFVKKAVDQSSKKRRRRRGAPSCKLWWLDKMC
Download sequence
Identical sequences F4WAJ6
Aech_08864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]