SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_08998 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_08998
Domain Number - Region: 296-319
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 188-212
Classification Level Classification E-value
Superfamily DPY module 0.000902
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 252-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0074
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_08998
Sequence length 374
Comment [mRNA] locus=scaffold69:190351:193476:- [translate_table: standard]
Sequence
MYTQAATLFLFLFITLVNGSHYVQYVQSRTIVITQNRSVPAESSDSPSLGGCDSYTCGVN
ARCTMSLGRPVCSCLNLHMGDPLAQCVRVECLKAACKPSPCGVNTQCEVINEVPVCTCLP
GYRGSPLSGCRHECESDIDCPHHLACSSSYKCENPCKCGENAECQVINHQAKCTCPKTWT
GNPFVACRPECTTHSECPSNKPACLYQKCVNPCDGVCGVHADCNLRDITPVCSCPKHMTG
NPFVSCRLFEPRDLCEPNPCGINAICTPGHDNTGKERPVCTCPTGYIGNALTSCQRGECF
TDSECPDNRACIDFTCKNPCTGHECGPSAECTPRRHIAVCTCPQGTRGDALYTCNPIESK
SVYNYGRAYRYRYY
Download sequence
Identical sequences F4X3F9
Aech_08998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]