SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09063 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09063
Domain Number 1 Region: 389-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-26
Family Laminin G-like module 0.0096
Further Details:      
 
Domain Number 2 Region: 1013-1190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-23
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 3 Region: 1212-1354,1389-1444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-20
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 4 Region: 1470-1645
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-18
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 5 Region: 45-104
Classification Level Classification E-value
Superfamily BPTI-like 3.69e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 6 Region: 170-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-17
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 7 Region: 607-752
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000183
Family Laminin G-like module 0.024
Further Details:      
 
Weak hits

Sequence:  Aech_09063
Domain Number - Region: 1191-1231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 364-404,761-807
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 800-866
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00251
Family Fibrinogen C-terminal domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_09063
Sequence length 2026
Comment [mRNA] locus=scaffold568:45393:57054:- [translate_table: standard]
Sequence
MIYRDKWILGILVLLNIVAKIPANQTNSPKTDMVEEMEEFTTTKRILPDRCLLKLEPGPC
KQFVHKWAFIKTEGKCRTFPYGGCHGNENRFNSEAECLHYCVGGDHTLPPYLVTKGSVFV
ATSTTTMSTPPSTTTTPRPTFTPPKPTKPPVPKHLRGKELTFMESGHEKTFMFAQSNTFI
QLDGPGIKTFQLRLCREISFQFRTKLPHGLLVYHSVKDRPESLDPYALYVIVEKGQLKVV
HVFGKQSTSLTVGQGLNRDEWHSVRVRIDVHGAKLIAEVDDKQAETILKVLERIVNYGVS
EELASVVLIGGLSSEERLHGVKYIIESFVGCIRDMILSSGKSASDLLPIRPLIATKHENV
KEGCIDKCRTRENLCFVPDQCVNHYNSLTCDCFGTNYEGERCDVYTATILTLRGSSYVSF
RVYDWKDRVHSSVNRISLAFKTKWDNSALFYASGEIDGTPHYIAASIINGSVHVELDFGH
NSKISTTLGDYVTSNYWNNLIIFHNGSTVFVSLDDEIKVLEVPGENCDIIIDPEIYIGGG
PELHKKKGLLSHNNFAGSLKYVFFNDKSIIYELKRSNPMVHYIGVLEPEYYEADVEVIPI
TYPFAGSHIWWPIEQTNSLKLNFDFKSSTPIAIIASGDVKSNRGVGYWELRQVNDEIRFQ
LVPVITEKNITLSTSVKFPPYNTSWHAVELNYTKGELNILLDYRNKQSKLFAMTFELGDK
VIIGSGNSNAGLVGCMREIRVNGQRIEPRYVINTERVVGEVALDNCQFVDPCKRPNTCEH
GGKCSVKEDRITCDCKDTGYIGKNCHFAQYRKTCEELALLGYTQDDVYKIDIDGNGRFPP
ASVKCEFQSIEDSTKTIVEHNLPSQIDVRSIIENDFSFNIKYRQFTAEMLQELISHSLYC
SQYVKYDCYKAPLELHSATWFLGSKDTTVDYIGNVNRGSCPCGMNRTCVNSNLSCNCDVS
AGNAGKWLSDEGYYETPDSLGITGMVFLQQRDLEEDARGRITLGPLECVETNTQKYVVTF
TTSQSYIEVPGWRKGDIAFSFRTTGEKAILLYQPPIRSNYPSFMVALTSEYRLTFNFTLN
TGTNRELQVESRRKLNNGEWQKIWIDYNDYHVRFMINTDFRMVDLFPEEEFGPFEGSMFI
GGATAEHLKTSSVRQGLIGCFRGLVVNGEILDIHSYMSVHLSEIIKDCKPSCQPNKCQNG
ARCVELWSNFECVCENRWAHLGTYCETNINNKALTFTSPGAFLKKNYFGSDDNEERLQLK
SMLLENILINLRTYDIHSLILYANDHLNNFAHLYISNGTIVYLFNAGNEIKNITVENPNV
NTGISVQIAIIRGENWTTLYVNEYNVTVNATPILLDTYSNKPWTNPEKEVLAPQRPPAPP
TDYFQVNLGGFDPDNLLRVGKEGALIQGYVGCLRGLMIGKYLVDLPSLASEANHEGSKGV
LPNCQMKCDTMPCKNLGICTEDFGRQESSCNCELTSYFGEHCADEKGADFSGESVLQREF
ELEGEVNQVKVQLAFSTNELRQRTTALLLVQTDNKRSYYLLVALTSEGLLIFEEDRDGSA
AGVRLSDRNFLNSARHSVYYVRDNNTAILLIDREPVQLLPIPGISIPDENETPGATEIQL
GGLNTTDSRFIAYKGYTGCLSNVVISINGGPDMKPLEEYMLFTKQGSETVRATIPAGVRS
AQCAVFHVQPGGLEPPKNDSVGRDKAWVEDPPERILYKSQYSGATQEEQGAGTYIFIVLC
CVFVIAVVGCIYEVCRSTRKDRQRKRAAASAAATGSGSQRWQSQQYTDSLVTATGVKAVG
FKNVMDDDKRPNGTHVKVSNAKEYKPLPNTEPKDLMNDKKIHIKAEEEPEKKELLGSMED
LREEPELEEREEEEEEEEEEEDTQEPEADENKDQPQEHQQKEQKDTSNDQDGELLVMPVR
NKTARRASLTDELDPDETQALLETNFSVTGLNEIKTERIIPKVNNTTKKPTPKRPMSLDL
NAPIKFRKLRGARPEKVTVKLINGDEASLQSRGKGHVDVASTNKNN
Download sequence
Identical sequences F4WZD8
Aech_09063 XP_011062630.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]