SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09086 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09086
Domain Number 1 Region: 1054-1332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-79
Family Protein kinases, catalytic subunit 0.0000000289
Further Details:      
 
Domain Number 2 Region: 138-303
Classification Level Classification E-value
Superfamily L domain-like 1.47e-43
Family L domain 0.0000218
Further Details:      
 
Domain Number 3 Region: 415-573
Classification Level Classification E-value
Superfamily L domain-like 1.64e-36
Family L domain 0.0000546
Further Details:      
 
Domain Number 4 Region: 578-733,852-887
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-23
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 860-1009
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000754
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 6 Region: 284-418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000168
Family Growth factor receptor domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_09086
Sequence length 1424
Comment [mRNA] locus=scaffold568:584957:591835:- [translate_table: standard]
Sequence
MKTRKSLLPIVLLCVTMVGLALCQEKRWPKAGTKYRDKSAKGKYDPDYADRTKEEDSEEE
LYNDRSSAATGYYESGSFDTSAVYRNNRAIDTSRSTDIGSKNSQQSSQSSNLPKSHTKSS
EEVGREKGRRHKNMTIGDGICQSIDIRNSVDTFAVLKDCRVIEGFLQIVLIENNTEADFE
NVSFPELREITGYFLLYRVEGLRSLSKLFPNLEVIRGDILLTDYAFMIYEMKSMQEIGLI
NLTKISRGGVRIEKNPALCFTNTVNWSLIVSAGENFIKDNRNEQSCPHHVKGCSQCPGSY
CWTAQRCQKLERPKCHEQCLGECYGPSDTECYVCKHYRHEGRCIESCPPNLYAYLSRRCI
SKDECQNMNHIRRFSKLEEIQTWRPFNNSCVTQCPDGFEDYVDDKNITNCRVCKGQCRKI
AKGAIIRHISDAQSFRGITVVKGALEFQIRNGNPNIMNELADAFGLIEEITEYLKITHSF
PITSLNFFKKLKVIKGENLDINNASFVVLDNPNLSSLFPLSQKITIETGRLFFHYNPKLC
LSKIEQFGKMVNITNFTDLEVQPESNGDKVACNIVNINITVKKREADHVILSWDSYKPPE
GQQLLNYLLSYIETDNENITYEANACGNNTWQIVDVGIPSWNSTVSKYITNLKPYTKYAA
YVKTFTTRNKNSSSSFVTPVGQSNIIFFRTKSAIPSVPTNVSSIAISDSEILLKWGPPVY
SNGPIGYYMISSTIRLDDKELIASRDYCVDALVNEAKEIHEVTIKTSLITNPNSCYFKDA
KTSKQFEIFCHKNMTISHLSPGWKDYCVFNDYNSPESKFYDVTNNLSTSTQEGQKTATDV
SVNAGNSITSSQLNDEMYIYNVSAQNTSYVLKNLRHYSLYTITIAACGVKDSDAPMCSTI
QYANVRTLKRSNADDVHNVKVYVTNNTIIEVIWESVKDPNAFTVSYTIEYTNMDVKDAKK
STECKPYIGHREKYIHHYIKNLSPGRYSLRMRSTSLAGDGYFTNTIYFSVGLSDNSRIMM
ATLLTLAVLIITVTAIIFLIRSHQKKRTQERLIASVNPDYIETKYVVDSWEVPRENVEIL
EELGLGNFGMVYRGYLDGTGQVAIKTISETASQREKNEFLNEASVMKNFSTWHIIKLLGV
VSMGNPPFVIMELMENGDLKTYLRRIRDTQMVPNASRIMRMAAEIADGMAYLESKKFVHR
DLAARNCMVSKDLVCKIGDFGMARDIYETDYYKIGKKGLLPIRWMAPENLSDGVFTSDSD
VWSFGVVLYEILTLAEIPYQGFSNEEVLHHVLRKGMLNIPRNCPETIQKLMEKCFKWRPS
ERPTFMEIVSELEPFLGQDFCEKSFYHSDEGIEIRSLGIKKVYHNAAPIRFHWGHETARW
VKDFEDNVTLLDQMKAGTSRGRIFKNGFQHFGNVTNFEDVPLDR
Download sequence
Identical sequences F4WZG2
Aech_09086 XP_011062671.1.86870 XP_011062672.1.86870 XP_011062673.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]