SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09101 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09101
Domain Number 1 Region: 93-264,452-645
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.68e-44
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 
Domain Number 2 Region: 783-1044
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-42
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 3 Region: 1717-1896
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-20
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 1528-1705
Classification Level Classification E-value
Superfamily Fibronectin type III 1.33e-19
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 5 Region: 1107-1145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 6 Region: 1183-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 7 Region: 1384-1421
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 1325-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 1144-1185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 10 Region: 1271-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1472-1509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 12 Region: 1227-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 13 Region: 1428-1465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  Aech_09101
Domain Number - Region: 1054-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1996-2092
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0107
Family Fibronectin type III 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_09101
Sequence length 2185
Comment [mRNA] locus=scaffold568:823817:833796:- [translate_table: standard]
Sequence
MAGRSSMALYYYFALILHLVLLTECDYDVRYGDAAKRLHVAEHNDQQYKKTFVIDKGSAD
LRDQDDSDREMSFERTRRDVPLPQHPNNSPNITAKVNPLNDSHQQLMVHWVGEGSNVIIC
LARDSSPVVRFQGGKFSSPNQPSAVYISYDYGDSFENKTEHFKVSSEADAPYAVVDKFTN
HPKYYQHCVFMDSLNSLIFITYNNGQTILRISLSFHPNEVSYFELDPRILVALDKTDTSR
KLWLTIDRGFTWMPIHQFVKAFFWSPYRELLIERMEPDGANTVLKLDLRNISSFIRGNNQ
LRARMSIRKEFIVVVENVEDFQIRGDFMFAVKKRNGTEHLDLFVSYKNQTFVQAHFNTEL
DCKEYHIVDVSFNRVFIAVKHGDTMINLYVSEVIDHEKAIFTLSLESILTFFPNSTWKDS
WLNDVADETFTDLYKVEGLRGIYIASRVKGTPKSSSIGPEHLESLITFDHGTTWNSLKAP
MANHEGFYIHCGKDCSLHLSQRFSQLYPVTRSATIMSSKSAPGIIMATGVIGSNLKGHPA
LYVSRDAGLKWKQVLKDYYFFNMGDHGGLLVAVKYFKSRGETRDISYSTDEGETWQTYEF
NEKMLRVYGLMTEPGENTTVFTMFGSDSGQHQWLIIKIDLRHVFERECTEDDYKFWSPTS
TEQPVMACVLGRKETYQRRALRSNCYQGVNYDRPVRLETCQCDANDYQCAYGFIPSGNPY
HCVHNKTMPDYDPYAVPTPCQPGMFYNRTKGYIKISDDDCTGGLAKNYEPDEIPCPMDER
PDFLLVAQREHITRIDLMDNNKLEKLPVHDLKNVIAIEFDMRNNCLYWADIVNDTIGRQC
LNGISYPEILVETDLSSIEGMAFDWVSNVLYFVDGVKMRIQIIRTDVGPSVGRMRRTILG
PNNLQKPRGIAVHPLRGYMFWTDWAPGNASVSRANLDGTDVKRLFLKPTVEWPNGITIDH
IAERIYWVDARADYIASSDLEGKRFKKIIANEARVSHPFAVAVFKDNLYWDDWKQSMIFV
ADKDHGVGISTILGFQIAGLMDLKIFAHSVQVGTNECAKNNTCSHICLGAPSNSYVCLCP
DGMVMTEGTCLCPGGIKPYSNSTCPRVASTCSSNQFACNNNVCIPEFWKCDGDNDCGDNS
DEIQCNRATCSPNNFECDDNKCIPKYWVCDLDRDCKDGKDEMNCTYSNCTETQFRCLNGR
CISHRWRCDGEDDCRDSSDEQNCTKNIQPNTCRADEIVCKTDHSCIPTSWKCDGEPDCED
GADEKDCSNMVCESWQFTCNNTKENGHRCIYKSWACDGDKDCIDGSDEVNCTTTTTLPTS
VIPILPTNSCNDWMFMCNNKKCVPYWWKCDSVDDCGDDSDEIGCGSSADGALEPTSPVHT
TQQSRICREHQFQCYNGECIENAWVCDGLKDCPSGEDEQHCDRGHTSCRENDQFMCRQDG
SCVSLSSMCNGVEECPDGSDELGCHTSELPATPSCYAGLFPCDDSRCFPLAALCDGNRDC
LDGFDEEHCEKNNSRKYQVLVMGVDERSINNSSLYLFWWMPIPSNVTFEFLPSIARAIPG
APWKNATEWIEDTEYQFNNLEPFTKYNLTVYVKAKGQSLSEVSPPAKYYMVMTGEGVPSE
PWNVKVAQKNGTRVEVTWRPPLHPNGVISGYLGYVTPPIPPLEFTRLKTSATIDIAFEAG
KNYSFWIVAKNRHYNSVSSQVVMLTFDGTANIDDIEDLRVVATTNHSVTLTWKKMQDVDG
YHITPRAPPNYPNLQTVTTMNNLMEVDKLAPGTKYTFEVGAMKKNYVGKVTSVTATTNGT
ALPTITKFDAQLVKSQRTTVKLTWDPPKSTRKIKWKYAIHYAINMEDFFKSAKFITANLT
ATIKDLEACEAYFFAVGVTGDYGAGPLNQPLTVMTHFSKRAPPKRLRVAPVQNKNDSMIV
SWMSSCPAVDEMISYTISVTEMIMNKHIVVTLPATNETVMKHMFHSIKYGGTYNITVATD
VENAIPTQPYIYIAPPIKPPHQLTVLHDNMEYLIYWQEPDLPEHIRKDTERYFEILVAEG
SRTINETTAKILVVKDPPPYRYKDAKTDTIYTFAARLVTNEGYQSPLSETWSTQISGSQL
PVIMNTSGILSLAIPICLIVIALGAALAYFVVRHRRLSHSFTQFANSHYDTRRGQATFPG
TTDGLEEEDSPVIRGFSDDEPLVIA
Download sequence
Identical sequences F4WZH5
Aech_09101 XP_011062685.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]