SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09180 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09180
Domain Number 1 Region: 83-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_09180
Sequence length 140
Comment [mRNA] locus=scaffold261:1126256:1128882:- [translate_table: standard]
Sequence
MSGYWDIGYVYTVHLGPVVLPFDKFYLLGIMLSKGCELDQMRYGCRIYNAQCSCGYGCKS
EYRYDNNDDCKLALKGRRSDICSRSKPCLNEGSCSQISSEPGFKCRCEGTGFYGTYCETP
CPRSDNTLFRGQFPYECVVI
Download sequence
Identical sequences F4WGX1
Aech_09180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]