SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09638 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09638
Domain Number 1 Region: 318-570
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-54
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 623-879
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-52
Family YWTD domain 0.00000908
Further Details:      
 
Domain Number 3 Region: 5-265
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-47
Family YWTD domain 0.00000823
Further Details:      
 
Domain Number 4 Region: 952-1166
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-27
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 5 Region: 580-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000372
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1330-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 1250-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1296-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 882-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  Aech_09638
Domain Number - Region: 273-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1208-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0781
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_09638
Sequence length 1615
Comment [mRNA] locus=scaffold81:577758:588616:+ [translate_table: standard]
Sequence
FLGSPLLLFGTHKDIRVTNISRSNKVNIIIKDLSEGASLDFFYERELICWSDSNLEMIQC
IHYNGTHTGEKITVVNSSLISPDGLACDWFTDKLYWTDGEKNRIEVTSIDGRNRKVLFWN
DIYQPRAIALAPMEGYLFWTDWGDVPKIERASMDGDPNTREIIVSDDIFWPNGLTIDYEN
RLVYWADGRLHFIAVMDYHGGNKRKLITRNLDYPFAITFFDNRLYWTDWKTWCIHSYDIN
QPQSHPRELFHGEYIPGDIEVWDARRQPGSNNPCKRNNGNCSHLCLLSSKEPGYSCACPT
GVKLIDKHTCANRPEQLLLIVQRTEICRISLDSPDYTNFVLPLTGIKHAIAIDFDPAEEL
LYWTDEQTTTIRRAPLDGMSQQNVISTEVANPDGIAIDWIARNLYWTDTGTDRIEVARLD
GKYRRVLVNEDLFEPRAIALAPEHGWMFWTDWSEKRPKIERSNLDGSERILLITKDIVWP
NGIALDLERNKIYWCDAKTDKIEVSNMDGTDRREVITDNLPHLFGLTLLGDYLYWTDWQR
RSIDRAHKLTGGEREVIVDQVPNVMGIKAIHLGKMNASNSPCAHDNGGCSHLCFNRPNNR
YVCACQMGYELTKDKRTCVVPEAFLLFSRRENLGRISIENINNDNIIPVTGIKDASAIDF
DLSENRIYWTDIKLKTITRVFINGSDIEKIVDLGLESPEGIAFDWIAHNLYWSDTITRRI
EMIRIEGGSRKILLWQNLLEPKNVAVDPERGHLYWAEWGNTGSIERAFLDGTQRQVIVSH
IGRANGLTIDHVGRKLYWADISTPAINCYDLLTQRGDVIISRHIVYPFSVTQYRDFIYWA
DWNTGDIERADKITGANRTKIHTNLASVTDLKVFHASRQSGSNPCAIANGNCSHLCIALP
DSNGGASVIHKCACPTHYNLARDNRTCMAPRHFMIYSQRTAIVRYLPDQTDDCADVTLRV
QGLKNVRAIEFDPVTQHVYWIDGRMTIRRALENQTQQQQHSSTVVVSIGNGHLFDLALDP
LGRLLFWTCSTNDALNVTRLDNGSALGIVVKGDGEKPRHIAIYSQQRLLFWTDVGKKRVV
RSKMDGKERHVIAGDLLEQPTGLTVDTTTYAVYWAYSKHIECSNFEGNDRKLLTSTQGSA
LHLAILFNYLYWYDRDAQVIERVNKTFDGNTRRGTQVTTGRISFTDLIAINMPEDLLMET
HVCSPFNDYGGCSHFCVGTNTIADEATATLPRCSCPKSLVLSDDGRTCRAAPVCGNDHFT
CAAPNAAVSKDCIPATWKCDGQTDCSDGSDELGCPTCSRDQFRCQNHCIELSLVCDGTQQ
CPDGSDEAQCCEIGQFQCVGNGVCISGTSLCDGWDDCADGSDEIPPACMSPHNPHRQNAG
PGINESGKTTYIIIILAVVFVVGTSILSYYYCRKKFIGNEGLPDILHDSAGDPLSPKPSN
NRMVKPMFVSQKNNRKDGGASGGLKVGMEAIRMSMLNGSSLGSSYDRSHITGASSSTRGS
SAGGYPQETLNPPPSPATIVSSTRCSSSNASRYKPYRHYRSINQPPPPTPCSTDVCDESD
SNYPARYRYESEPFPPPPTPRSVYHSDAANSCPPSPSSRSSTYFSPLPPPPSPVP
Download sequence
Identical sequences F4X5W2
Aech_09638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]