SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09749 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09749
Domain Number 1 Region: 121-237
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000864
Family Spermadhesin, CUB domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_09749
Sequence length 514
Comment [mRNA] locus=scaffold185:965957:1004943:- [translate_table: standard]
Sequence
MERENEELEELKCNSYSQIGEKSLIYVRRQLWQLNDNGSAFSATAKRKWESLKFLNNRIQ
IAREKRLFSLFTLVKFDNGICDGLNGENGTCIAAAECGQRGGIFSGVCANGYGICCIITV
SCDGMTADNNTHFVNPNYPSTFDGMESCQVTIVKSDPDVCQYRLDFVQFNIRGPETTNNI
CIYDQFIVSGGNPVPTICGNNDGNHMYIDTGIGQTNPVTLIFVTSGNSFSRSWKVRISQI
RCSTIYRAEEGCLQYFTGVSGQIKSFNYDPMIGLQLSNQDYSICIRMERNFCGIQYMACS
DDAQEMSTTLSTTQIMRSNSFTLTGNTQTTQIMSMTGTSCMTDWLSIPCATNLDRLPSTS
MTCVDRLCGGTFNSETLNLNGSSVIKDLRSAYDNFDKHLRALKASSPSPMLTDIASRLAE
LKPWSTSLSSAILKSYIPSRTSALLPTVLLCLSISACYRVILWNVSVSRKKAIASALLII
WFSFSAIRDRWIDAKGLLFNDLNFDICCQGHDSE
Download sequence
Identical sequences F4WBE3
Aech_09749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]