SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09973 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09973
Domain Number 1 Region: 192-300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 464-592
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-22
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 601-722
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-19
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 323-448
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-16
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 5 Region: 51-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000353
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 6 Region: 725-765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000903
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_09973
Sequence length 768
Comment [mRNA] locus=scaffold237:420824:434138:+ [translate_table: standard]
Sequence
MVWCVPGGAREIFDAPLPQDYFPSLPPPPGGFTTAKILKCDQKFVSTPDGPLNGTFHAPT
LANPEGEPRQCVYTFLAGPRQRVELIFTSFGLRGKPPDCIHEYLDIYSEIRSENTTKLIE
TPFGGRFCGPIPPRRRVSLYQGIALSFYTDKNVTLPHIFGGIYKFINASEYEVGTPEPST
PCTFTIHVDIKRNGNILSPTYPGTYPKDLICSYQFVGHRGQRVRLEFRDFDLFFGGPHCP
LDYVKVYDGPDNSTAVIGTYCGQQRNLVLYSSENSLFVLFSTLRRTANTQNRGFKGIFEF
SESFVSLDFITEYQGEHIRGSECDQKILSKKETSGFVVSPNFPYPYLPKVVCRYFIYGMQ
DSQHLERVRLEFQVFTIQMPKGETSCTDGYLKLYLKGQEATDSYDKFDYEMCGNNSNPNY
VVSDGPRLVMVFSSGELQAQGFKAKYTFETEYKIPGTAAPDGSCTFTYRSSSRKRGEFNS
PRYPSNYPSDTNCTYFFLATPDEQVALIFDHFKVRTRNDNVTIGYYGYEFCQEDWLEIYN
MYRDDTEKLIGRYCGGTAPGPVESNLGALGLKVILHSDSELVYSGFKARYTFEIAKPIFG
DCGSNISSLNYGIITSPNFPNNYDGPAKNLASKSCNWFIRVRPDQRILLNFEVFSVEGDQ
LVRGCPAAVLRMWYSSIPRELCGVKDPNTKWDYLSEDHNMRLSFISADKAVGQQGFRAVW
TEVSMNTDCENQFLCSKSKYCINESLRCNNIDNCGPDDSSDEENCKFR
Download sequence
Identical sequences F4WFM5
Aech_09973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]