SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10164 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10164
Domain Number 1 Region: 2317-2554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.94e-38
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 2088-2128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 3 Region: 2169-2208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 2009-2052
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 2056-2089
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 2131-2169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  Aech_10164
Domain Number - Region: 2237-2317
Classification Level Classification E-value
Superfamily SRCR-like 0.000233
Family Scavenger receptor cysteine-rich (SRCR) domain 0.033
Further Details:      
 
Domain Number - Region: 431-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000536
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_10164
Sequence length 2561
Comment [mRNA] locus=scaffold196:831400:845419:- [translate_table: standard]
Sequence
MSDAAGTDNPAFANEDECVSGSKLENGSQQQAALNQDHKSSADSAPVENGHQRSFISQHY
VEPIKPSSEPCYKTETRIEVPADNTEKTVPESKLNGVHGNGNNNDASFLNNSATSVQIND
SGKKEQIEAVNLELVSMRPYTGNNIQTKGQEACEVPADPYEEYFVPVNEHRKYISRGPEA
EVETTVAGVRFDLGPGVGREGLSLRDPAAGLVDYSHWLTALRGEKLYVTKDKRSRNSYWR
RMAWGCALLVIVIAVIIAILAATGVFPIPATEPLENVEENNTRQFNEVQTAGSREYVKGP
PLSPPPLTSTFSPWPTTDETLFDIVPDALDGTLRLDDFNWNDDFSDIKSRVYRQVSSEIE
EHLGNILRKAGSMSIIKVYDINKEGEIRFRISHPPRNAPEESQEYIEDVLRKNGNMIGEY
HLNRLHVGKLIDQCEYGNLECTGNCKYDYSSGIFVCTCKLGEILHHDGKTCVDDSDLSNV
EMDDVIPQSTTEPIDDFQGRSRDPGAINFEPRHPNTWKNTDFKTGSAETDTSTMKSKTKD
VNPEQSDISIEQQTEFIPTTKHSVFENDDSHWNHEYVHHSKETTIEAGPPIKTSQKPFAE
LKPTSEPEPTTEPESNVEPEPNAEPKPSAEPESSAESEPSTEPEPSAEPKPNAEPELSAE
PEPNAEPEPNAEPEPSAEPKLSAESEPTISSEIIVPPKLTVKPEPEPTPILSTAVPNPAS
EPEPTAKPKIAPEVESTIKAESITERESTAKLLPVTESATTINETDTEVKSKTESQHLTT
ESYLKSKTEIFDRPEFSVKPMSHDDTSESSTQTSSSDDAGTTNVFKSLIELTDKSDNSNN
NETLITTVKPNENPTDNDTPLQIIPLTSKDINDNVDTKTTTIQSYSKNDEITESTIIEAD
LTTLNYRDLKQNGDVNVTSAKSENHAESVTEQFTENPNLRKDKENVSTKTNFDTNLSNIQ
NGNSATNEHDLITKQKSDIDLNVFEQVSLTTATTTVPVTSVEEKTESTTKFIINDRHSST
GHIHTIEINGINNRNPETNNYTKVYETTTIPETTPIDIFTQPILGYREELVPEPALQPNT
PDSNEKNVIEHMPTTIFPKVPENFAHNVEPLREPIVKSADDEHIMLIPKSEQPVEIHAII
PELIPEQATNKSLKAENSITKENKSVEDTTSIDSSTIHTNENIVPASNNKHAVRPDEIQE
HLTSHPLHPAVFPENSVDHFTGKSDDRPAEDMSPFLPDVHKEKESLKKPRLDKDEQDGPN
PFETHIDDVITHRPLIRNNADRVNETETKDLLIDVISKNNEKKVDIMKEITQNHEINTTN
NADNSTNTNNTESKILNVLHQNNTAKSIDNDETKGITDQENGGFSEDKELKVIPLAVEDK
SVDSISQTTLQPIDKKTEPEVVTSAGKKVQEVEGITIESVTSSEKPEENAVEDHYNDITD
ETLSKGYQHDNTGIPIKVIESSKKAVLKDIDPIKVSYNGPYSSLTTFDVMKKKNETNEKI
SSDMTQSPMVTKTDGVVNNQMEDGRLTTQEPVLPIEIQQEMSTTTDKVEITTVIGNGKHE
ENNTEPPNVGQSDEKEAITAQMSTTQATLETKTTAQIPILPEELQTTESDILSTTLNEEI
SSIDKKMETTDKTVSTDDANNATKKNEAEKESAVTPSNVMDTSERSMAATRVYESNISLG
TGRKIEYDKNGQIIESVTESIKIETTPMVFTIEKDIAGGVEGTSPMPNDVTTTEDVRPVT
EMLDDTEPMIDYRILFTTIPPKPILLDSELSEETLRVIPLEKSQESKKKPIDKKGFDKHK
YKKEKDLSLEDQNEDNVLTEKFDQTILSQTEPSTITTTDHEELQDSVVSSDIYPNIPRFT
VADKEGNIVPISKWKDTTARTENKDVIAETKPKNYPSFIPVSEEIIESVPVTEPYVIMRN
YTRPMIITNETEKTAANETTVEGQTNTRANETTGQNATFFSDQVFSDHEEAKVHHVTEES
TTQTSTLKVEIENITASSPSEFPFPGSLLKCSTGQFQCVNGTSRNGAYCIPQSAKCDSEN
DCSDGSDEWNCTAEDCSSNFRCANGHCLKRHLVCNKIVDCDDGSDEHNCENWQCQSDEFR
CPSGRCIPGLWRCDGRPDCEEHRDEYNCAETCGNNEYLCPTEKWCIPQAWHCNGVADCVN
GEDEKLCDCTLDQFKCQSGGCIPRNQICDGIENCPDYSDEWSCLIANITADRNLTNTETD
SNTASEANRVPFLKIRQYNGDYQLVCSDGWSEEFSDSYCQALGFAGSDETLESFAWDRSQ
KILRLKTNPNYRLPLVTNLEEVGFCVSDKVMQVSCQEFICGLHYTEELTTRLTDPPERWS
STALLKKSEEGTVCTASIIGPMHALTSYSCIYRHKEKSGWQLFTNGNMLKGNAVKNIIPY
PRVKYNQFLYNNDIALIELGEPLVFSRNISAICLPRQPIQPEQICVTVGWTFPKNGEMNL
QQYLKFMPLPLNNSDKCNATSHYAGFITKHDICMDKNPCYNDKGTPLMCASESQGAPGRW
EIQGLLSHRRECLGSHPAIYSSLEPALPWLRETVPALQTQS
Download sequence
Identical sequences F4WCZ0
XP_011050509.1.86870 Aech_10164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]